DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and hsd17b1

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_002935954.1 Gene:hsd17b1 XenbaseID:XB-GENE-6463399 Length:295 Species:Xenopus tropicalis

Alignment Length:249 Identity:69/250 (28%)
Similarity:110/250 (44%) Gaps:44/250 (18%)


  Fly    44 MRGQVVWITGASSGIGRALALSLARHG---VKLVLSARRLEQLEQVQE---ECLAAARGLLATKD 102
            |..:||.|||.|||||..||:.||...   .|:..:.|.|.:.|.:.|   :|.|         |
 Frog     1 MEKRVVLITGCSSGIGLGLAVRLASDSYQRFKVYATMRDLSKKENLMECVRDCHA---------D 56

  Fly   103 VL-VIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVH 166
            .. ::|||:  .|:......|......|:|:||.|||............|..:::|::::|..:.
 Frog    57 TFEILQMDV--TDQQSVVSTTEKIKEQRVDILVCNAGVGLMGPLECHSYESMKKIFDVNLFGTIS 119

  Fly   167 LSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMR--KLDVSLF 229
            ..:..:....::..||  |..:||:.|...:||:..|||:|.|:.....||.:.::  .:.|||.
 Frog   120 TIQAFLPGMKQRKSGR--IIISSSVGGLQGIPFNDIYCASKFAVEGLCESLAIVLQHFNIHVSLI 182

  Fly   230 APGPIATDFLQEAFTGSQGGKVGLSTANQKRMTA-------------QRCGDLF 270
            ..||::|:|:....        |:. ||..|:.|             |.|..||
 Frog   183 ECGPVSTNFMNNLH--------GVD-ANDSRLQAGDSDTRSLYAQYLQHCHSLF 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 69/250 (28%)
adh_short 47..245 CDD:278532 59/207 (29%)
hsd17b1XP_002935954.1 NADB_Rossmann 4..260 CDD:304358 68/247 (28%)
adh_short 4..195 CDD:278532 59/204 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.