DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and hsd11b1

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_012811347.1 Gene:hsd11b1 XenbaseID:XB-GENE-960491 Length:292 Species:Xenopus tropicalis

Alignment Length:236 Identity:60/237 (25%)
Similarity:108/237 (46%) Gaps:41/237 (17%)


  Fly     1 MSFLEFLLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALS 65
            |:.|:.|::...::..||             :|.:......:.::|:.|.:||||||||..:|..
 Frog     1 MALLKALVVFTGIFLAVY-------------FYSAGDVFEPAMLKGKRVIVTGASSGIGEQMAYH 52

  Fly    66 LARHGVKLVLSARRLEQLEQVQEEC----LAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNH 126
            ||:.|..::::||..|:|::|..:|    .|:|..:..:.|.    |....|..||..     |.
 Frog    53 LAKMGSHILITARTEEKLKKVVAQCTHLGAASAHYIAGSMDT----MTFAKLVVHKAE-----NL 108

  Fly   127 FHRLDVLV-NNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSS 190
            |..||:|: |:.|.:. ..:.:..|:..|:|.|::|.:...::...:....:.|   |::...||
 Frog   109 FGGLDMLILNHIGHTY-FGYFDGNIDHVRDLLEINVLSYATMTVAALPMLKKSN---GNVVVVSS 169

  Fly   191 IAGFSPVPFSPTYCAAKHALNAYLLS----LKVEMRKLDVS 227
            :||...:.|      .|..|...|||    :...:.||.:|
 Frog   170 VAGELKLSF------LKLFLGILLLSKCSLILAGVVKLSIS 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 54/194 (28%)
adh_short 47..245 CDD:278532 53/191 (28%)
hsd11b1XP_012811347.1 NADB_Rossmann 31..277 CDD:304358 54/194 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D906746at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.