DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and dhrs7c

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_012826975.1 Gene:dhrs7c XenbaseID:XB-GENE-5956201 Length:704 Species:Xenopus tropicalis

Alignment Length:236 Identity:63/237 (27%)
Similarity:119/237 (50%) Gaps:18/237 (8%)


  Fly     1 MSFLEFL---LLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRAL 62
            |.||.||   ||:|.:..:||:...:     |.|       :|.|:::.:||.||.|.||:|:..
 Frog     1 MGFLTFLIVPLLILGISGIVYIYREV-----VRL-------MSRSALKNKVVVITDAISGLGKEC 53

  Fly    63 ALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHF 127
            :......|.:|||..:..|:||.:.:..::.|...:.....||: :|:.|::..:.....:.:.:
 Frog    54 SRVFHSAGARLVLCGKTWEKLEALHDALISVADPSVTFTPKLVL-LDISDINNMEAMGKEIQDCY 117

  Fly   128 HRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIA 192
            ..:|||:|||....:.....|.:|:|:::.:.:.|..:.|.:.::.:.:.:.  .|.|...::|.
 Frog   118 GCVDVLINNASMKMKGPLQSVSLELDKKIMDANYFGPITLVKAILPHMISRR--TGQIVLVNTIQ 180

  Fly   193 GFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLDVSLFAPGP 233
            |...|||...|.|:|||:..:...|:.|:.:.|||:....|
 Frog   181 GKIGVPFRAAYAASKHAIQGFFDCLRAEVEEFDVSVSTVSP 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 49/191 (26%)
adh_short 47..245 CDD:278532 49/188 (26%)
dhrs7cXP_012826975.1 11beta-HSD1_like_SDR_c 35..257 CDD:187593 49/191 (26%)
adh_short 38..226 CDD:278532 49/188 (26%)
LAP2alpha 425..629 CDD:288419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.