DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and LOC100124812

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001096251.1 Gene:LOC100124812 XenbaseID:XB-GENE-1000830 Length:323 Species:Xenopus tropicalis

Alignment Length:232 Identity:70/233 (30%)
Similarity:117/233 (50%) Gaps:22/233 (9%)


  Fly    44 MRGQVVWITGASSGIGRALALSLAR---HGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLV 105
            |..:.|.|||.|||||.|:|..|||   ...|:..:.|.|.:    |::.:||..|.|. |.:.:
 Frog     1 MAQKTVLITGCSSGIGLAIATKLARDEQKRFKVYATMRNLAK----QDDLIAATEGYLG-KTMEI 60

  Fly   106 IQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRL 170
            .:||:...|..:..::::.:  ..:|:||:|||...........||..:.:.:.:.|.:|.|.:.
 Frog    61 KEMDVCCEDSIRNCVSSIPD--RHIDILVSNAGVGLIGPIECQTIEEMKTVMDTNFFGLVRLLKE 123

  Fly   171 VVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMR--KLDVSLFAPGP 233
            .:.....:..  |||...||:.|...:.|:..|.|:|.|:..:..||.::..  ||.:||..|||
 Frog   124 TLPDMKRRKS--GHIVIISSVMGIQGILFNDVYAASKFAVEGFCESLAIQALKFKLHLSLIEPGP 186

  Fly   234 IATDFLQEAFTGSQGGKVGLSTANQKRMTAQRCGDLF 270
            :.|:|.::.|  ..|.|:.||.|:::  ||    |:|
 Frog   187 VVTEFERKVF--EDGMKMDLSAADKE--TA----DMF 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 70/233 (30%)
adh_short 47..245 CDD:278532 60/203 (30%)
LOC100124812NP_001096251.1 type1_17beta-HSD-like_SDR_c 4..261 CDD:187666 69/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.