DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and hsd11b1l.2

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_004910661.1 Gene:hsd11b1l.2 XenbaseID:XB-GENE-5834068 Length:291 Species:Xenopus tropicalis

Alignment Length:286 Identity:78/287 (27%)
Similarity:139/287 (48%) Gaps:30/287 (10%)


  Fly    16 VVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRL 80
            |..|||.:.:...|..:|:|. .::...:||:.|.|||:|:|||..:|...|:.|..::|:|||.
 Frog     4 VKLVLLSLFVGYTVNYFYRSE-SMNPELVRGKRVLITGSSTGIGEQIAYEFAQMGAHIMLTARRH 67

  Fly    81 EQLEQVQEECL---AAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLV-NNAGRSQ 141
            ::|::|..:||   ||:...:|:        ||.:|...:......:.....||.|| |:.|.|.
 Frog    68 QRLQEVANQCLKLGAASADYVAS--------DMGNLTSAQYVAQETVKKLGGLDYLVLNHIGGSA 124

  Fly   142 RASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAA 206
            ...:.:.:::.......::..:.|.|:...:|...|   .:|.|...||::|....||:.:|||:
 Frog   125 SFGFFKGDMDPVVGSITINFLSYVQLTSTALRALQE---SQGSIVVMSSMSGRIGAPFTTSYCAS 186

  Fly   207 KHALNAYLLSLK----VEMRKLDVSLFAPGPIATDFLQEAFTGSQGGKVGLSTANQKRMTAQRCG 267
            |.||..:..||:    ::...:.|::...|.|.|    |......|.||.: ||:.|...|:   
 Frog   187 KFALEGFYSSLRREFDLQKNNMSVTVAILGYIDT----ENAVKKVGNKVTM-TASSKEDCAR--- 243

  Fly   268 DLFAVALANKMDL--TWCGLFPVNLL 291
            ::...|:..:.:|  .:.|:.|:.||
 Frog   244 EVVKAAVLRRPELFYPYWGIKPIVLL 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 71/259 (27%)
adh_short 47..245 CDD:278532 56/206 (27%)
hsd11b1l.2XP_004910661.1 11beta-HSD1_like_SDR_c 31..280 CDD:187593 71/259 (27%)
PRK06181 33..283 CDD:235726 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D906746at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.