DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31937 and hsd11b1l

Sequence 1:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001090784.1 Gene:hsd11b1l XenbaseID:XB-GENE-5851849 Length:286 Species:Xenopus tropicalis

Alignment Length:233 Identity:68/234 (29%)
Similarity:117/234 (50%) Gaps:20/234 (9%)


  Fly    17 VYVLLW--ILLDCNVALWYKSRFG-VSLSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSAR 78
            :::..|  |:|..:.|...:..|. .:|::.|   |.:||||:|||..:|...||.|.||||:||
 Frog     3 IHIKRWCFIILVASAAYILRDSFDPETLANTR---VLVTGASTGIGEEIAYHYARAGAKLVLTAR 64

  Fly    79 RLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLV-NNAGRSQR 142
            |...|::|:..||.     |..|:|.::..||...:..:..:...|:....||.|| |:.|.:..
 Frog    65 REHALQEVKSRCLE-----LGAKNVFLVVADMASHNAREQVVAEALSALGGLDYLVLNHIGWTPF 124

  Fly   143 ASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAK 207
            ..| :.::...|.|.|::..:.:||:...:.|..:   .:|.|...||:...:|:|::.:|.|:|
 Frog   125 KMW-DGDVNHTRWLMEVNFLSYIHLATAALPYLTQ---SKGSIIVLSSLTAKTPIPYTTSYAASK 185

  Fly   208 HALNAYLLSLKVEM----RKLDVSLFAPGPIATDFLQE 241
            .||..:..||:.|:    ..:.::|...|.|.|....|
 Frog   186 FALEGFFSSLRHELTMQNNPVSITLCILGLIDTQSAME 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 62/204 (30%)
adh_short 47..245 CDD:278532 61/201 (30%)
hsd11b1lNP_001090784.1 11beta-HSD1_like_SDR_c 30..277 CDD:187593 63/207 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D906746at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.