DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT33D and MMT1

DIOPT Version :8

Sequence 1:NP_723732.2 Gene:ZnT33D / 326167 FlyBaseID:FBgn0051860 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_013902.1 Gene:MMT1 / 855215 SGDID:S000004789 Length:510 Species:Saccharomyces cerevisiae

Alignment Length:526 Identity:93/527 (18%)
Similarity:183/527 (35%) Gaps:163/527 (31%)


  Fly   144 LIRSEYYENSQ----TKSDAIKSLSNNQLSEESPEFLNKLRRIEEASKPKTWKRPTPVVLKSNQN 204
            |:|.|....|.    .||..|.....|::..|    :|:|:|..|..|....:      |:.|..
Yeast    23 LVRKENLHISTGVKVEKSSIINQKDPNKVRVE----INELKRQAEIEKAAIKE------LEKNPQ 77

  Fly   205 YSANKNSENALDAKPQTATNTEETHGCINILKVPFQSNLYYVPEKPSRQDKGSGTSDFQPGAPET 269
            |.....:.|:.|......:.||:.    :|:.:                    ||          
Yeast    78 YQKLAEAFNSHDHVHLRESETEQN----DIISL--------------------GT---------- 108

  Fly   270 PIVENSAVDSDRKAVEIMPENVKNSEEKKIDNSDSTKTVTITGHSHITAKWDGHCHFK------- 327
                                 :::.:..|.:.:|...::.:..|:|.    .||.|..       
Yeast   109 ---------------------IRDYKSSKCEQADKPSSLNLHSHTHS----HGHTHSHAAHNPLL 148

  Fly   328 -------ERETGVDKAARRVLIIACILCTIFLILEVIGGILSNSLAIATDAAHLLTDLASFLISI 385
                   .:..||     |:..:...:.....|.:..|||:.:|.|:..||.|.::|:.|.|:::
Yeast   149 VLSTEQIRKNAGV-----RITWVGLGVNVGIAIGKFFGGIVFHSQALFADAIHAISDMVSDLLTL 208

  Fly   386 SALHLAGRPSSERLNYGWHRAEVIGAMVSIFFIWVVTGILVYMAIMRWVNQDFELDAKIMLITSA 450
            .::.||....:....||:.:.|.:|:: ::..|..:.||.:     .|               |:
Yeast   209 LSVGLAANKPTADYPYGYGKIETVGSL-AVSTILAMAGISI-----GW---------------SS 252

  Fly   451 LAILFNVIMAM-------QLQHGHSHS------LPGVHKMSKDAGSVLGSKMILLLGKSVSMQ-- 500
            |..|...::..       .|.|.|::|      :..::.....|.|:...:.|....:.:::.  
Yeast   253 LCALVGPVIPHTIIDTIGNLGHAHTYSEDIIEDVTDINAAWIAAASIAAKEWIFRATRKIAINTN 317

  Fly   501 ----YAAKGHENINVRAAIIHVV----GDI--IQSF----GVFVAALIIFFWPEWAFMDSVCTFV 551
                .|...|..::...:::.:|    |.:  |||.    |:.|:.|||     .|..:.:|..:
Yeast   318 SNVLMANAWHHRVDSLTSLVALVAISTGYLVNIQSLDTIGGLIVSGLII-----KAGGEGMCIAI 377

  Fly   552 FSVLVLVVTFKILRDVLMVLMEATPDFMDYEE-VKQT---FLSISGVEHVHNLRIWALSINKVAL 612
            ..    ::...:.||        .|.:::.|. ||.|   .:|.:..:..:.|:...|..:...|
Yeast   378 KE----LIDQSVSRD--------DPRYLEIETLVKDTLNKLISNNNSQKPYGLKELTLLSSGPNL 430

  Fly   613 SAHLAI 618
            ..||.:
Yeast   431 RGHLTL 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZnT33DNP_723732.2 CDF 350..651 CDD:273544 59/303 (19%)
Cation_efflux 350..572 CDD:279834 48/251 (19%)
MMT1NP_013902.1 FieF 150..488 CDD:223131 62/331 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96772792
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.