DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT33D and Slc30a5

DIOPT Version :8

Sequence 1:NP_723732.2 Gene:ZnT33D / 326167 FlyBaseID:FBgn0051860 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_075023.2 Gene:Slc30a5 / 69048 MGIID:1916298 Length:761 Species:Mus musculus

Alignment Length:490 Identity:103/491 (21%)
Similarity:204/491 (42%) Gaps:113/491 (23%)


  Fly   191 WKRPTPVVLKSNQNYSANKNSENALDAKPQTATNTEETHGCINILKVPF--QSNLYYVPEKPSRQ 253
            |..|....|::....:..:::|:.|.             |.:.:..|.|  .:|:...|.|  |.
Mouse   318 WTHPITDQLRAMNRAAHQESTEHVLS-------------GGVVVSAVFFILSANILSSPSK--RG 367

  Fly   254 DKGS--GTSDFQPGAPE-TPIVENSAVDSDRKAVEIMPENVKNSEEKKIDNSDSTKTVTITGHSH 315
            .||:  |.|      || ||:..... |:.:.:.:.:|..:|:|.::.::.|||           
Mouse   368 QKGTLIGYS------PEGTPLYHFMG-DAFQHSSQSVPRFIKDSLKQVLEESDS----------- 414

  Fly   316 ITAKWDGHCHFKERETGVDKAARRVLIIACILCTIFLILEVIGGILSNSLAIATDAAHLLTDLAS 380
                                  |::....| |..:|..:|:..|:|:|||.:.:|..|:|.|.::
Mouse   415 ----------------------RQIFYFLC-LNLLFTFVELFYGVLTNSLGLISDGFHMLFDCSA 456

  Fly   381 FLISISALHLAGRPSSERLNYGWHRAEVIGAMVSIFFIWVVTGILVYMAIMRWVNQDFELDAKIM 445
            .::.:.|..::...::...:||:.|.|::...::..|:.|:...:...::.|.::.. |||..::
Mouse   457 LVMGLFAALMSRWKATRIFSYGYGRIEILSGFINGLFLIVIAFFVFMESVARLIDPP-ELDTNML 520

  Fly   446 LITSALAILFNVIMAMQLQHGHSHSLPGVHKMSK-----DAGSVLGSKMILLLGKSVSMQYAAKG 505
            ...|...::.|:|......|.|||.    |..|:     |.|.                .:.|.|
Mouse   521 TPVSVGGLIVNLIGICAFSHAHSHG----HGASQGNCHSDHGH----------------SHHAHG 565

  Fly   506 H--------------ENINVRAAIIHVVGDIIQSFGVFVAALIIFFWPEWAFMDSVCTFVFSVLV 556
            |              .|.|:|...:||:.|.:.|.||.|:.::|..: .|...|.:|:...:||:
Mouse   566 HGHDHGHSHGFTGGGMNANMRGVFLHVLADTLGSIGVIVSTVLIEQF-GWFIADPLCSLFIAVLI 629

  Fly   557 LVVTFKILRDVLMVLMEATPDFMDYEEVKQTFLSISGVEHVHNL------RIWALSINKVALSAH 615
            .:....:::|...||:...|.  |:|  |:..:::..::.:..|      ..|..|.:.||.:.|
Mouse   630 FLSVIPLIKDACQVLLLRLPP--DHE--KELHIALEKIQKIEGLISYRDPHFWRHSASIVAGTIH 690

  Fly   616 LAISKDADPQLILEEATTLIHKRFKFFETTIQIEE 650
            :.::.:...|.|:::.|.:: |.......|||:|:
Mouse   691 IQVTSEVLEQRIVQQVTGIL-KDAGVNNLTIQVEK 724

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZnT33DNP_723732.2 CDF 350..651 CDD:273544 73/327 (22%)
Cation_efflux 350..572 CDD:279834 55/241 (23%)
Slc30a5NP_075023.2 CDF 426..725 CDD:273544 73/327 (22%)
Cation_efflux 426..645 CDD:279834 55/241 (23%)
His-rich loop 540..574 11/54 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.