| Sequence 1: | NP_723732.2 | Gene: | ZnT33D / 326167 | FlyBaseID: | FBgn0051860 | Length: | 701 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_075023.2 | Gene: | Slc30a5 / 69048 | MGIID: | 1916298 | Length: | 761 | Species: | Mus musculus | 
| Alignment Length: | 490 | Identity: | 103/490 - (21%) | 
|---|---|---|---|
| Similarity: | 204/490 - (41%) | Gaps: | 113/490 - (23%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly   191 WKRPTPVVLKSNQNYSANKNSENALDAKPQTATNTEETHGCINILKVPF--QSNLYYVPEKPSRQ 253 
  Fly   254 DKGS--GTSDFQPGAPE-TPIVENSAVDSDRKAVEIMPENVKNSEEKKIDNSDSTKTVTITGHSH 315 
  Fly   316 ITAKWDGHCHFKERETGVDKAARRVLIIACILCTIFLILEVIGGILSNSLAIATDAAHLLTDLAS 380 
  Fly   381 FLISISALHLAGRPSSERLNYGWHRAEVIGAMVSIFFIWVVTGILVYMAIMRWVNQDFELDAKIM 445 
  Fly   446 LITSALAILFNVIMAMQLQHGHSHSLPGVHKMSK-----DAGSVLGSKMILLLGKSVSMQYAAKG 505 
  Fly   506 H--------------ENINVRAAIIHVVGDIIQSFGVFVAALIIFFWPEWAFMDSVCTFVFSVLV 556 
  Fly   557 LVVTFKILRDVLMVLMEATPDFMDYEEVKQTFLSISGVEHVHNL------RIWALSINKVALSAH 615 
  Fly   616 LAISKDADPQLILEEATTLIHKRFKFFETTIQIEE 650  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| ZnT33D | NP_723732.2 | CDF | 350..651 | CDD:273544 | 73/326 (22%) | 
| Cation_efflux | 350..572 | CDD:279834 | 54/240 (23%) | ||
| Slc30a5 | NP_075023.2 | CDF | 426..725 | CDD:273544 | 73/326 (22%) | 
| Cation_efflux | 426..645 | CDD:279834 | 54/240 (23%) | ||
| His-rich loop | 540..574 | 11/53 (21%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 549..576 | 6/42 (14%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG1230 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||