DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT33D and SLC30A10

DIOPT Version :8

Sequence 1:NP_723732.2 Gene:ZnT33D / 326167 FlyBaseID:FBgn0051860 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_061183.2 Gene:SLC30A10 / 55532 HGNCID:25355 Length:485 Species:Homo sapiens

Alignment Length:377 Identity:90/378 (24%)
Similarity:162/378 (43%) Gaps:72/378 (19%)


  Fly   341 LIIACILCTIFLILEVIGGILSNSLAIATDAAHLLTDLASFLISISALHLAGRPS-SERLNYGWH 404
            |:...:|...|.:.|::.|.|.||:|:.:|:.::|:||.|..:.:||.::|.||: .....||:.
Human    11 LLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYIARRPTRGFSATYGYA 75

  Fly   405 RAEVIGAMVSIFFIWVVTGILVYMAIMRWVNQDFELDAKIMLITSALAILFNVIMAMQLQ----- 464
            ||||:||:.:..|:..:...:...|::|....:...|.:::||...|.:|.||:..:..|     
Human    76 RAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVGVLGLLVNVVGLLIFQDCAAW 140

  Fly   465 -----HGHSHSL-----------PGVH---------KMSKDAGSVLGSKMILLLGKSV------- 497
                 .|.|..|           ||..         :.:.|..:......:.|.|.||       
Human   141 FACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAADPTAPGSDSAVTLRGTSVERKREKG 205

  Fly   498 -------------------SMQYAAKGHENINVRAAIIHVVGDIIQSFGVFVAALIIFFWP---- 539
                               .|....|..|.:|:|..::||:||.:.|..|.:.|:|.:..|    
Human   206 ATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRGVLLHVMGDALGSVVVVITAIIFYVLPLKSE 270

  Fly   540 ---EW-AFMDSVCTFVFSVLVLVVTFKILRDVLMVLMEATPDFMDYEEVKQTFLSISGVEHVHNL 600
               .| .::|...|.:..:::|...|.::::...:|::..|..::.||:.....::.|:..||.:
Human   271 DPCNWQCYIDPSLTVLMVIIILSSAFPLIKETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEV 335

  Fly   601 RIWALSINKVALSAHLAISKDADPQLILEEATTLIHKRFK---FFETTIQIE 649
            .||.|...|:..:.|:...||...|    :|:|.|.:.|.   ....|||.|
Human   336 HIWELVSGKIIATLHIKYPKDRGYQ----DASTKIREIFHHAGIHNVTIQFE 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZnT33DNP_723732.2 CDF 350..651 CDD:273544 88/369 (24%)
Cation_efflux 350..572 CDD:279834 66/287 (23%)
SLC30A10NP_061183.2 CzcD 10..383 CDD:224151 89/376 (24%)
Cation_efflux 20..307 CDD:279834 66/287 (23%)
Required for plasma membrane localization. {ECO:0000269|PubMed:25319704} 308..485 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.