DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT33D and Slc30a7

DIOPT Version :8

Sequence 1:NP_723732.2 Gene:ZnT33D / 326167 FlyBaseID:FBgn0051860 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001178644.1 Gene:Slc30a7 / 310801 RGDID:1307873 Length:378 Species:Rattus norvegicus

Alignment Length:355 Identity:72/356 (20%)
Similarity:146/356 (41%) Gaps:88/356 (25%)


  Fly   334 DKAARRVLIIACILCTIFLILEVIGGILSNSLAIATDAAHLLTDLASFLISISALHLAGRPSSER 398
            ||.:|.:....|:..: |..:|::.||.||.|.:.:|:.|:..|..:.|..::|..::....::.
  Rat    32 DKTSRNLFFFLCLNLS-FAFVELLYGIWSNCLGLISDSFHMFFDSTAILAGLAASVISKWRDNDA 95

  Fly   399 LNYGWHRAEVIGAMVSIFFIWVVTGILVYMAIMRWVNQDFELDAKIMLITSALAILFNVIMAMQL 463
            .:||:.||||:...|:..|: :.|...::...:.......::..:.:|:.|.|..:.|::.....
  Rat    96 FSYGYVRAEVLAGFVNGLFL-IFTAFFIFSEGVERALAPPDVHHERLLLVSILGFVVNLVGIFVF 159

  Fly   464 Q-----------HGHSHSL----------------------PGVHKMSKDAGSVLGSKMILLLGK 495
            .           |||||||                      .|.|....|               
  Rat   160 NHGGHGHSHGSGHGHSHSLFNGALDHSHGHEDHCHSHGAKHGGAHSHDHD--------------- 209

  Fly   496 SVSMQYAAKGHENIN-----------------VRAAIIHVVGDIIQSFGVFVAALIIFFWPEWAF 543
                  .|.||.:::                 ::...:|::.|.:.|.||..:|:::   ..:..
  Rat   210 ------HAHGHGHLHSHDGPSFKETAGPSRQILQGVFLHILADTLGSIGVIASAIMM---QNFGL 265

  Fly   544 M--DSVCTFVFSVLVLVVTFKILRDVLMVLMEATPDFMD------YEEVKQTFLSISGVEHVHNL 600
            |  |.:|:.:.::|::|....:||:.:.:||:.||..::      |:.|:|    :.||.::...
  Rat   266 MIADPICSILIAILIVVSVIPLLRESIGILMQRTPPSLENVLPQCYQRVQQ----LQGVYNLQEQ 326

  Fly   601 RIWALSINKVALSAHLAISKDADPQLILEE 630
            ..|.|..:....:..|.::.|||.:.||.:
  Rat   327 HFWTLCSDVYVGTLKLVVAPDADARWILSQ 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZnT33DNP_723732.2 CDF 350..651 CDD:273544 68/340 (20%)
Cation_efflux 350..572 CDD:279834 52/274 (19%)
Slc30a7NP_001178644.1 CzcD 31..376 CDD:224151 72/356 (20%)
Cation_efflux 48..296 CDD:279834 52/273 (19%)
His-rich loop 161..220 13/80 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.