DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT33D and Slc30a4

DIOPT Version :8

Sequence 1:NP_723732.2 Gene:ZnT33D / 326167 FlyBaseID:FBgn0051860 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_035904.2 Gene:Slc30a4 / 22785 MGIID:1345282 Length:430 Species:Mus musculus

Alignment Length:495 Identity:148/496 (30%)
Similarity:249/496 (50%) Gaps:86/496 (17%)


  Fly   188 PKTWKR--------PTPVVLKSNQNYSANKNSENALDAKPQTATNTEETHGCINILKVPFQSNLY 244
            |..|||        .||:.|          |..:|.|...:.   ::|.....|.|:|....:..
Mouse     4 PGAWKRLKSLLRKDDTPLFL----------NDTSAFDFSDEV---SDEGLSRFNKLRVVVADDDS 55

  Fly   245 YVPEKPSRQDKGSGTSDFQPGA-PETPIVENSAVDSDRKAVEIMPENVKNSE-EKKIDNSDSTKT 307
            ..||:|..            || |.....::|.:|.|      :|  :.||: ..|:|..|:.. 
Mouse    56 EAPERPVN------------GAHPALQADDDSLLDQD------LP--LTNSQLSLKMDPCDNCS- 99

  Fly   308 VTITGHSHITAKWDGHCHFKERETGVDKAARRVLIIACILCTIFLILEVIGGILSNSLAIATDAA 372
                               |.||....:..:..|.||.:|..:|:|.|::||.::|||||.|||.
Mouse   100 -------------------KRRELLKQRKVKTRLTIAAVLYLLFMIGELVGGYMANSLAIMTDAL 145

  Fly   373 HLLTDLASFLISISALHLAGRPSSERLNYGWHRAEVIGAMVSIFFIWVVTGILVYMAIMRWVNQD 437
            |:||||::.::::.||.|:.:..:.|..:|:||.||:.||:|:..::|:.|.|:|.|:.|.::.:
Mouse   146 HMLTDLSAIILTLLALWLSSKSPTRRFTFGFHRLEVLSAMISVMLVYVLMGFLLYEAVQRTIHMN 210

  Fly   438 FELDAKIMLITSALAILFNVIMAMQL-QHGHSHSLPGVHKMSKDAGSVLGSKMILLLGKSVSMQY 501
            :|::..:||||:|:.:..||||...| |.||.||....|.:..::.|::.|      |.:     
Mouse   211 YEINGDVMLITAAVGVAVNVIMGFLLNQSGHHHSHAHSHSLPSNSPSMVSS------GHN----- 264

  Fly   502 AAKGHENINVRAAIIHVVGDIIQSFGVFVAALIIFFWPEWAFMDSVCTFVFSVLVLVVTFKILRD 566
              .|.:::.||||.:|.:||::||.||.:||.||.|.||:...|.:||::||:||...||:|:.|
Mouse   265 --HGQDSLAVRAAFVHALGDLVQSVGVLIAAYIIRFKPEYKIADPICTYIFSLLVAFTTFRIIWD 327

  Fly   567 VLMVLMEATPDFMDYEEVKQTFLSISGVEHVHNLRIWALSINKVALSAHLAI-----SKDADPQL 626
            .:::::|..|..::.:.:|::.:.|..|..|.:|.||:|:..|.....|:.:     ||..:.| 
Mouse   328 TVVIILEGVPSHLNVDYIKESLMKIEDVYSVEDLNIWSLTSGKSTAIVHMQLIPGSSSKWEEVQ- 391

  Fly   627 ILEEATTLIHKRFKFFETTIQIEEY-SPGMENCGQCLSPS 665
              .:|..|:...|..::.|||::.| ...:..|..|.|.|
Mouse   392 --SKAKHLLLNTFGMYKCTIQLQSYRQEVIRTCANCHSSS 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZnT33DNP_723732.2 CDF 350..651 CDD:273544 107/307 (35%)
Cation_efflux 350..572 CDD:279834 86/223 (39%)
Slc30a4NP_035904.2 CDF 123..414 CDD:273544 107/307 (35%)
Cation_efflux 123..333 CDD:279834 86/223 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11562
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.