DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT33D and Y105E8A.3

DIOPT Version :8

Sequence 1:NP_723732.2 Gene:ZnT33D / 326167 FlyBaseID:FBgn0051860 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_740931.2 Gene:Y105E8A.3 / 173299 WormBaseID:WBGene00013668 Length:746 Species:Caenorhabditis elegans

Alignment Length:318 Identity:70/319 (22%)
Similarity:147/319 (46%) Gaps:25/319 (8%)


  Fly   337 ARRVLIIACI---LCTIFLILEVIGGILSNSLAIATDAAHLLTDLASFLISISALHLAGRPSSER 398
            :||:....|:   .|.:    |.:.|..:|||.:.:|..|:|.|.::.::.:.|..:|..|.:..
 Worm   401 SRRIFWFLCVNLGFCGV----EFLYGFWTNSLGLISDGFHMLFDCSALVMGLVASVMARWPPTRH 461

  Fly   399 LNYGWHRAEVIGAMVSIFFIWVVTGILVYMAIMRWVNQDFELDAKIMLITSALAILFNVIMAMQL 463
            ..:|:.|.|::...::..|:.|:...::..|:.|..:.. .::...:|..:...::.|:.....|
 Worm   462 FTFGFGRVEILSGFINALFLCVIALFILIEALERLFDPP-NINTDRLLFVAISGLIVNLFGMYSL 525

  Fly   464 -QHGHSHSLPGVHKMSKDAGSVLGSKMILLLGKSVSMQYAAKGHENINVRAAIIHVVGDIIQSFG 527
             :|||||.....|..|...|...|              ::..|..|.|::...:||:.|.:.|..
 Worm   526 GEHGHSHGGGSSHGHSHGGGGSHG--------------HSHGGGGNANMQGVFLHVLADTLGSVF 576

  Fly   528 VFVAALIIFFWPEWAFMDSVCTFVFSVLVLVVTFKILRDVLMVLMEATPDFMDYEEVKQTFLSIS 592
            |.::.|:| .|..|.::|.:|:.:.|:|::...:.:|...:..|::..|:..::|......|.|.
 Worm   577 VIISTLLI-QWFGWVWVDPLCSLILSLLIIGSVYPLLVSSISTLLQDVPEEEEFEYHINEILEIE 640

  Fly   593 GVEHVHNLRIWALSINKVALSAHLAISKDADPQLILEEATTLIHKRFKFFETTIQIEE 650
            .||...|..:|....:....|.|:.:.::|:.|:|....:.:: |......:|:|:|:
 Worm   641 HVESYSNAHMWQHKSDINVASVHVQVKEEANAQMIRHRVSNIL-KSTGATHSTVQVEK 697

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZnT33DNP_723732.2 CDF 350..651 CDD:273544 66/303 (22%)
Cation_efflux 350..572 CDD:279834 49/223 (22%)
Y105E8A.3NP_740931.2 CzcD 397..696 CDD:224151 69/316 (22%)
Cation_efflux 413..620 CDD:279834 50/227 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.