DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31689 and ftsE

DIOPT Version :10

Sequence 1:NP_001259954.1 Gene:CG31689 / 326154 FlyBaseID:FBgn0031449 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_417920.1 Gene:ftsE / 947968 ECOCYCID:EG10340 Length:222 Species:Escherichia coli


Alignment Length:186 Identity:54/186 - (29%)
Similarity:89/186 - (47%) Gaps:18/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KSVLKGIKGTFKSGELTAIMGPSGAGKSSLMNILTGLTKSGVSGKI-------------EIGKAR 93
            :..|:|:....:.||:..:.|.||||||:|:.::.|:.:.. :|||             |:...|
E. coli    15 RQALQGVTFHMQPGEMAFLTGHSGAGKSTLLKLICGIERPS-AGKIWFSGHDITRLKNREVPFLR 78

  Fly    94 KLCGYIMQDDHFFPYFTVEETMLMAATLKISNQCVSLKEKRTLIDYLLNSLKLTKTRQTKCSNLS 158
            :..|.|.||.|.....||.:.  :|..|.|:.  .|..:.|..:...|:.:.|....:.....||
E. coli    79 RQIGMIFQDHHLLMDRTVYDN--VAIPLIIAG--ASGDDIRRRVSAALDKVGLLDKAKNFPIQLS 139

  Fly   159 GGQKKRLSIALELIDNPAVLFLDEPTTGLDSSSSFDTIQLLRGLANEGRTIVCTIH 214
            ||:::|:.||..:::.||||..||||..||.:.|...::|.......|.|::...|
E. coli   140 GGEQQRVGIARAVVNKPAVLLADEPTGNLDDALSEGILRLFEEFNRVGVTVLMATH 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31689NP_001259954.1 3a01204 15..622 CDD:273361 54/186 (29%)
ftsENP_417920.1 PRK10908 1..222 CDD:182829 54/186 (29%)

Return to query results.
Submit another query.