DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31689 and Abcg5

DIOPT Version :10

Sequence 1:NP_001259954.1 Gene:CG31689 / 326154 FlyBaseID:FBgn0031449 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_114090.1 Gene:Abcg5 / 27409 MGIID:1351659 Length:652 Species:Mus musculus


Alignment Length:115 Identity:26/115 - (22%)
Similarity:38/115 - (33%) Gaps:46/115 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 WTVVFFIVMKGIQSSGKVVY---FTSLFPYIVLTIFFIRGITLKGAGAGL--------------- 278
            |.||..:.::...|...|:.   |....|.::|         :.|.|.||               
Mouse   110 WQVVGTVGLEEGSSQSNVLSCSDFKMSRPTLLL---------MGGEGDGLSSELRQLCDVLITIP 165

  Fly   279 --MHMYTPKVEKLLEPTVWLDAATQVFYSFGLAFGSLIAFGSYNTPKNNC 326
              .||: |.||.|           .|..:.|:...||:     :|.|.||
Mouse   166 PRRHMH-PGVESL-----------NVSVATGILLHSLL-----STRKGNC 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31689NP_001259954.1 3a01204 15..622 CDD:273361 26/115 (23%)
Abcg5NP_114090.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
ABCG_White 50..276 CDD:213201 26/115 (23%)
3a01204 61..646 CDD:273361 26/115 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.