DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: erm and NUC

Sequence 1:NP_001259891.2 Gene:erm FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_199229.1 Gene:NUC AraportID:AT5G44160 Length:466 Species:Arabidopsis thaliana

Alignment Length:470 Identity:93/471 (20%)
Similarity:147/471 (31%) Gaps:162/471 (34%)


  Fly   249 SPVAQRTAQSSGLQANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGG 313
            |.|.|..:..||............|:..:.||......:..|    :|.|:..:...||      
plant     3 SEVLQTISSGSGFAQPQSSSTLDHDESLINPPLVKKKRNLPG----NPDPEAEVIALSP------ 57

  Fly   314 KPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIH---------T 369
                                |..|..:.    |:|:||||||::...|..|:..|         |
plant    58 --------------------TTLMATNR----FLCEVCGKGFQRDQNLQLHRRGHNLPWKLKQRT 98

  Fly   370 SEKPHK----C--QTC-----GKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLT 423
            |::..|    |  :||     .:|....:.:..|.....|.|.:.||.|.|.:..:.::|.|..|
plant    99 SKEVRKRVYVCPEKTCVHHHSSRALGDLTGIKKHFCRKHGEKKWTCEKCAKRYAVQSDWKAHSKT 163

  Fly   424 HSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLHEIGGDLD 488
             .|.:.|:|: |...|.:..:...|                :.||.  .|.:...|::.:     
plant   164 -CGTREYRCD-CGTIFSRRDSFITH----------------RAFCD--ALAEETAKINAV----- 203

  Fly   489 DLDMPPTYDRRREYTRREPLASGYGQASGQLTPDSSSGSMSPPINVTTPPLSSGETSNPAWPRSA 553
                          :....||:.....|..|......|:..||:.    |......:||      
plant   204 --------------SHLNGLAAAGAPGSVNLNYQYLMGTFIPPLQ----PFVPQPQTNP------ 244

  Fly   554 VSQYPPGGFHHQLGVAPPHDYPSGSAFLQL------QPQQPHPQSQQHHQQQQRLSETFIAKVFX 612
                   ..|||      |..|..|:.|.|      .|.||.|....               ||.
plant   245 -------NHHHQ------HFQPPTSSSLSLWMGQDIAPPQPQPDYDW---------------VFG 281

  Fly   613 QRYYAESL--NSSTGS---TSTTSSTVTTTTTAISSMATSRSDLLIDXLQFVAAAAAASSSNSGQ 672
            ....|.:.  |::|..   |...::::|||||                    .:|.:..||:..|
plant   282 NAKAASACIDNNNTHDEQITQNANASLTTTTT--------------------LSAPSLFSSDQPQ 326

  Fly   673 DTGESPSPELGCTAL 687
            :...:.:..:..|||
plant   327 NANANSNVNMSATAL 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 40/186 (22%)
C2H2 Zn finger 320..340 CDD:275368 2/20 (10%)
zf-H2C2_2 332..357 CDD:290200 10/25 (40%)
zf-C2H2 346..368 CDD:278523 10/22 (45%)
C2H2 Zn finger 348..368 CDD:275368 9/20 (45%)
zf-H2C2_2 363..385 CDD:290200 9/42 (21%)
C2H2 Zn finger 376..396 CDD:275368 5/27 (19%)
zf-H2C2_2 389..413 CDD:290200 7/24 (29%)
C2H2 Zn finger 404..424 CDD:275368 7/20 (35%)
zf-H2C2_2 416..441 CDD:290200 8/25 (32%)
C2H2 Zn finger 432..452 CDD:275368 4/20 (20%)
C2H2 Zn finger 460..478 CDD:275368 3/18 (17%)
NUCNP_199229.1 C2H2 Zn finger 68..88 CDD:275368 9/20 (45%)
C2H2 Zn finger 109..137 CDD:275368 5/28 (18%)
C2H2 Zn finger 144..163 CDD:275368 6/19 (32%)
C2H2 Zn finger 171..187 CDD:275368 4/33 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
10.910

Return to query results.
Submit another query.