DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: erm and CG32767

Sequence 1:NP_001259891.2 Gene:erm FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001162674.1 Gene:CG32767 FlyBaseID:FBgn0052767 Length:1281 Species:Drosophila melanogaster

Alignment Length:865 Identity:173/866 (20%)
Similarity:301/866 (35%) Gaps:234/866 (27%)


  Fly    26 SPVMESAASEQNP---------------AQQSQQQDEQSAKRACPLKFSIAKIMEPDHRPSQVPP 75
            |.:.|....|::|               |.::.::.|.:|..:..:|.   ::.|.|..|     
  Fly   203 SDIKEEDEEEEDPELNDENLQDIEEEAQAAEADEEPETTAHLSTQVKL---ELEEDDEMP----- 259

  Fly    76 PQPAPVSFATNDDDEDEDPEIDADSERSCSPIEVISLDQSPSTVNYDSA---------FKKYVPG 131
                       |::|:||.:.|.:.:......::.:..|:.......:|         .::.|..
  Fly   260 -----------DEEEEEDEDDDEELQHGQLEYQISAATQTAGAATSSAAGGAATAGGGSQQLVQL 313

  Fly   132 PC----SGATSSVASPPSTAAVQQ--------------------FVSSRHQELLSQYPLLYYAPN 172
            |.    |..|..::.|.:.||:.|                    :|......::|:.|:...  |
  Fly   314 PAGSIVSTTTHRLSVPVTEAALVQLQRRPVYISNAVGGLTAGATYVRMPAAAVISRSPMTVL--N 376

  Fly   173 QLMCAAAAAQYAALTAQQQSLASAAHLSSFTASLNASLHHSQSLRRNLGHPLAAAAAVAAVAQSQ 237
            .:..|..|.|....|.|||:.|:||.......:|.......:.           .|......|.|
  Fly   377 VVQQALPATQLILQTQQQQTPAAAAAEQQLALALEQQRQQQEQ-----------QAQQQRQQQQQ 430

  Fly   238 AVPNLQHTLEKSPVAQRTAQSSGLQANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSI 302
            .....|...::....|:.||.. .|...:::...|.|.:.|.|...:|:.::...:.|.:...:.
  Fly   431 QEQQRQQQQQQQQQQQQQAQQE-QQRQQQQQLQQQQQQQQTHPVKHSASGSSSTNNNSTTNSTNS 494

  Fly   303 EDSSPGSASGGKPKTFSCLECGKVFNAHYNLTRHMPVHTG-----------------------AR 344
            .:::| :|:.....::.|:||.:.|::......|...|..                       .:
  Fly   495 NNNTP-AATATVTTSYQCVECVEKFDSKELFDIHRSGHANNMKCAICNMVLKSLKNYEKHCLRCK 558

  Fly   345 PFVCKVCGKGFRQASTLCRHKIIHTSEK----PHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCE 405
            |:.|::||:..|......:|..:||.::    .:||:.|.|.|........|.:||.......||
  Fly   559 PYECQICGRVVRFRPNFIKHMRVHTGQQSERHKYKCEVCHKEFMSFEYFKVHKKIHNENVNLTCE 623

  Fly   406 YCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRN 470
            .|||.|....:.:.|...|||.|.:||::|.|.|.|.|||..|..||....|:.|::|.|.....
  Fly   624 ICGKVFSALASLRGHSKLHSGVKLHKCDVCGKGFGQRYNLKIHARTHTGDFPFECKICKKKLHTQ 688

  Fly   471 FDLKKHMR-KLHEIGG------------------------------------------------- 485
            ..|:.||: .|.:..|                                                 
  Fly   689 SSLQTHMQVHLRDQPGAAAAAATAAGAASSKASNSSNSSNSSNSSSSNSSSNGVSAAVSAATTTT 753

  Fly   486 DLDDLDMPPTYDRRREYTRREPLASGYGQ--------ASGQLTPDSSSGSM---SPPINVTTPPL 539
            .:..|:.|...:|....:.::...|.:.|        .||. ..|.|.|.|   |..:|.||..|
  Fly   754 TIVKLEPPHEIERPGTSSNQQLQQSQHHQMELDDQSGLSGD-EEDGSGGGMNSSSHIVNATTNRL 817

  Fly   540 SSGETSNPAW-------PRSAVSQYPPGGFHHQLGVAPPHDY-----------------PSGSAF 580
            ::||.|:.:.       ..|:.|..|..  .||:.....|.:                 |:.:..
  Fly   818 TTGEDSSESSNASLHLNQHSSTSSSPAS--QHQVSSHQQHVHQQQQQQQQSQQQYLVSAPTRTIV 880

  Fly   581 LQLQPQQPHPQSQQHHQQQQRLSE---TFIAKVFXQRYYAESLNSSTGSTSTTSSTVTTTTTAIS 642
            ::...||...|.||..||||..|:   ...|:|. .   ....::.:|:||:|:|:..::|..::
  Fly   881 IKNYMQQGSQQQQQQQQQQQHTSDPTPVLHAQVIQS---GAGTSNGSGNTSSTNSSSNSSTNIVT 942

  Fly   643 SMA---TSRSDLLIDXLQFVAAAAAASSSNSG-------QDTG-----ESP-SPELGCTA----- 686
            :.|   .|....||. ...:..:..:|:.:.|       |.||     :|| |....|::     
  Fly   943 TNAGGNLSNGSQLIRKTPIIHHSTGSSNGSGGSALTSVVQQTGVISPAQSPSSSSTSCSSSTVLV 1007

  Fly   687 ----------LGSAVRALNG 696
                      ..||..||.|
  Fly  1008 SKATGVPLSIASSAAAALGG 1027

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 50/193 (26%)
C2H2 Zn finger 320..340 CDD:275368 5/20 (25%)
zf-H2C2_2 332..357 CDD:290200 7/48 (15%)
zf-C2H2 346..368 CDD:278523 5/22 (23%)
C2H2 Zn finger 348..368 CDD:275368 5/20 (25%)
zf-H2C2_2 363..385 CDD:290200 8/26 (31%)
C2H2 Zn finger 376..396 CDD:275368 6/20 (30%)
zf-H2C2_2 389..413 CDD:290200 9/24 (38%)
C2H2 Zn finger 404..424 CDD:275368 7/20 (35%)
zf-H2C2_2 416..441 CDD:290200 10/25 (40%)
C2H2 Zn finger 432..452 CDD:275368 10/20 (50%)
C2H2 Zn finger 460..478 CDD:275368 6/18 (33%)
CG32767NP_001162674.1 C2H2 Zn finger 537..557 CDD:275368 0/20 (0%)
C2H2 Zn finger 562..582 CDD:275368 5/20 (25%)
C2H2 Zn finger 594..614 CDD:275368 6/20 (30%)
C2H2 Zn finger 622..642 CDD:275368 7/20 (35%)
zf-C2H2 648..670 CDD:278523 11/22 (50%)
C2H2 Zn finger 650..670 CDD:275368 10/20 (50%)
zf-H2C2_2 662..684 CDD:290200 9/22 (41%)
C2H2 Zn finger 678..698 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24393
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.