DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: erm and sp5l

Sequence 1:NP_001259891.2 Gene:erm FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_012811854.1 Gene:sp5l XenbaseID:XB-GENE-1000647 Length:344 Species:Xenopus tropicalis

Alignment Length:429 Identity:95/430 (22%)
Similarity:140/430 (33%) Gaps:163/430 (38%)


  Fly    13 SPAG----EIAMMPPSKSPVMESAASEQNPAQQ---------------SQQQDEQSAKRACPLKF 58
            ||.|    .:|:.|.:..||:.:..:.:...|.               |......|...:..:.|
 Frog    24 SPEGGLLSSLALFPSTCVPVITAKPAPREYTQSAYDPVAPTAGMFQLWSNDVPANSGIGSHAVTF 88

  Fly    59 SIAKIMEPDHRPS-------QVPPPQPAPVSFATNDDDEDEDPEIDADSERSCSPIEVISLD--- 113
            .:.|:..|.|..:       ..||..|...||                   ..||::|::..   
 Frog    89 GVPKVQYPGHMQTIASHELPLTPPADPTAYSF-------------------DLSPVKVLAPQVQS 134

  Fly   114 ------QSPSTVNYDSAFKKYVPGPCSGATSSVASPPSTAAVQQFVSSRHQELLSQYPLLYYAPN 172
                  |.||.|..|  |..::.|             ||...|:.:||.|.:..:.:.|...:||
 Frog   135 NAAYHFQDPSAVAQD--FSGFMQG-------------STTLTQRHLSSTHIDEQTWWSLQQTSPN 184

  Fly   173 QLMCAAAAAQYAALTAQQQSLASAAHLSSFTASLNASLHHSQSLRRNLGHPLAAAA--AVAAVAQ 235
                                     :..||                :|.:||...:  ..||:.|
 Frog   185 -------------------------NFPSF----------------HLANPLVVGSQPQFAALLQ 208

  Fly   236 SQAVPNLQHTLEKSPVAQRTAQSSGLQANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQG 300
            |.:...|..|                    :|.|                      |.:.|:.| 
 Frog   209 SSSKTLLNST--------------------RRCR----------------------RCKCPNCQ- 230

  Fly   301 SIEDSSPGSASGGKPKTFSC--LECGKVFNAHYNLTRHMPVHTGARPFVCK--VCGKGFRQASTL 361
                :||.:...||.|...|  ..||||:....:|..|:..|.|.|||:|.  :|||.|.::..|
 Frog   231 ----ASPSNEEPGKKKLHICHLPGCGKVYGKTSHLKAHLRWHAGERPFICNWMLCGKSFTRSDEL 291

  Fly   362 CRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYK 400
            .||...||.||...||.|||.|.||..|:.|::.|...|
 Frog   292 QRHLRTHTGEKRFGCQECGKRFMRSDHLSKHTKTHQNKK 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 43/111 (39%)
C2H2 Zn finger 320..340 CDD:275368 7/22 (32%)
zf-H2C2_2 332..357 CDD:290200 12/27 (44%)
zf-C2H2 346..368 CDD:278523 9/24 (38%)
C2H2 Zn finger 348..368 CDD:275368 8/22 (36%)
zf-H2C2_2 363..385 CDD:290200 12/22 (55%)
C2H2 Zn finger 376..396 CDD:275368 10/20 (50%)
zf-H2C2_2 389..413 CDD:290200 4/13 (31%)
C2H2 Zn finger 404..424 CDD:275368
zf-H2C2_2 416..441 CDD:290200
C2H2 Zn finger 432..452 CDD:275368
C2H2 Zn finger 460..478 CDD:275368
sp5lXP_012811854.1 COG5048 <129..330 CDD:227381 72/304 (24%)
C2H2 Zn finger 249..268 CDD:275368 6/19 (32%)
zf-C2H2 274..298 CDD:278523 9/24 (38%)
C2H2 Zn finger 276..298 CDD:275368 8/22 (36%)
zf-H2C2_2 290..313 CDD:290200 12/23 (52%)
C2H2 Zn finger 306..326 CDD:275368 10/20 (50%)
zf-C2H2 306..326 CDD:278523 10/20 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.