DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31650 and rcn3

Sequence 1:NP_001162879.1 Gene:CG31650 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_989389.1 Gene:rcn3 XenbaseID:XB-GENE-5781886 Length:323 Species:Xenopus tropicalis

Alignment Length:338 Identity:112/339 (33%)
Similarity:189/339 (56%) Gaps:31/339 (9%)


  Fly     3 RNLPL-LPLTLCAVALLAAVGPMPAHGAVANSHKHEKHLSKERVKDGIYAPRDAHHHGEDGEHNV 66
            |:||: |.:|||    ::.|..:|               :||: ||.::..:|...|..|.:...
 Frog     2 RSLPVFLLVTLC----VSWVMGVP---------------TKEK-KDRVHHSKDLSDHEHDDQKGF 46

  Fly    67 EFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEA 131
            ::||||.:|. :||:.||.|:|:||:.||..:|..||.:.|::|...||.|||....::.:.|::
 Frog    47 QYDHEAFLGK-EEARTFDQLTPEESQHRLGKIIDQMDKDNDKYITSGELFAWIKHVSRRWNLEDS 110

  Fly   132 ADRFEEIDQDADERITWKEYLQDTYAM---EDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTN 193
            ..:.::.|.:.|..|:|.||.:..|..   :.|:| .:..|.|. |..:||:.:|:..|..||.:
 Frog   111 EKQGKKYDTNKDGMISWDEYAKGVYGHLLGKGEEF-YDVADKDK-ERYRKMMMRDERRFKVADKD 173

  Fly   194 KDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHHDKE----WLI 254
            .|.:.|.|||..|.:|||:..|..|::..|::|.|.:.||.::..|::.|..:.::.|    |:.
 Frog   174 GDLIATREEFTAFLHPEEYGYMQDIVITETIEDIDKNDDGIVDVHEYIADMYTPNEDEPEPDWVK 238

  Fly   255 TEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDT 319
            ||:::|....|.|.||.:...|:..||:|.:...|:.|..||...:|:|.|.:|:..|||:|::.
 Frog   239 TERQQFTDFRDINKDGKMDRTEISQWILPHDYDHADLEAKHLVYESDKDKDGKLTKKEILDNWNM 303

  Fly   320 FVGSEATDYGDHL 332
            ||||:||:||:.|
 Frog   304 FVGSQATNYGEDL 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 16/53 (30%)
EFh 100..153 CDD:298682 16/53 (30%)
EF-hand_7 184..241 CDD:290234 20/57 (35%)
EFh 184..241 CDD:298682 20/57 (35%)
EFh 228..281 CDD:298682 16/57 (28%)
rcn3NP_989389.1 EFh_CREC_Calumenin_like 38..306 CDD:320024 91/271 (34%)
EF-hand motif 38..67 CDD:320024 12/30 (40%)
EF-hand motif 73..102 CDD:320024 12/29 (41%)
EF-hand motif 109..138 CDD:320024 7/29 (24%)
EF-hand motif 162..191 CDD:320024 12/29 (41%)
EF-hand motif 199..228 CDD:320024 7/29 (24%)
EF-hand motif 240..269 CDD:320024 10/29 (34%)
EF-hand motif 276..306 CDD:320024 13/30 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D372250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.