DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31642 and AgaP_AGAP009940

DIOPT Version :9

Sequence 1:NP_723159.1 Gene:CG31642 / 326149 FlyBaseID:FBgn0051642 Length:557 Species:Drosophila melanogaster
Sequence 2:XP_319067.3 Gene:AgaP_AGAP009940 / 1279355 VectorBaseID:AGAP009940 Length:299 Species:Anopheles gambiae


Alignment Length:139 Identity:25/139 - (17%)
Similarity:56/139 - (40%) Gaps:13/139 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 QTRSTRSRNLASVRPVAGGNTRSEQRTEQVFDSALSLALMVVQLDNMDSTAADFPERCYEILQQT 212
            |....|.:.|:.::.....:....::|.|..:......|.....|.:.:.|....:...:||.: 
Mosquito   155 QYEEKRVQQLSEIKEKLKTHAADIEKTRQSLEQQKVEELQKHLEDKLRNAATLRDDNIKKILDR- 218

  Fly   213 ETVLMQHRSSRVPDMEA----IESF-----VRVIEDQVVTSMADRRQRLGASSSSLHRLTRIEAI 268
               |.:|.:.::.::.|    ||:.     .|:||:::.|:..:|.:.|.....::.:..|...:
Mosquito   219 ---LKEHNTDKLNEVRATIDQIEALKTTEKTRIIENKLSTAEQNREKELQKKLENIRKHERRAEL 280

  Fly   269 SPGTNTALA 277
            ......|||
Mosquito   281 VRQNKAALA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31642NP_723159.1 ZZ_PCMF_like 15..65 CDD:239078
AgaP_AGAP009940XP_319067.3 Stathmin 58..187 CDD:279209 5/31 (16%)
DUF2884 <152..>239 CDD:302976 14/87 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.