DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31642 and STMN2

DIOPT Version :9

Sequence 1:NP_723159.1 Gene:CG31642 / 326149 FlyBaseID:FBgn0051642 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001186143.1 Gene:STMN2 / 11075 HGNCID:10577 Length:187 Species:Homo sapiens


Alignment Length:176 Identity:30/176 - (17%)
Similarity:67/176 - (38%) Gaps:42/176 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 VRRQTARRTGEPIGIALQ--SAVASSSRSGKAGSSSGVA--KAQTKTQ-GDQPTKKVSTVITSPL 354
            |::...|.:|:...:.|:  |.::.:.|:..:.....::  :.|.|.: .::..|.....:...|
Human    42 VKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQL 106

  Fly   355 KDKRFLCSKLVSGNGQKWESKLLKATFTEAMFCSMLADEELFQPPIGLPWTANFMLDAVEPSGSV 419
            .:||            :.|.::|:....|....|.:|:|:|                 :.....:
Human   107 AEKR------------EHEREVLQKALEENNNFSKMAEEKL-----------------ILKMEQI 142

  Fly   420 KSNGKLLLYPVKTKELMERFYRGLAEYKTWIGYQTEPTAESKATEL 465
            |.|.:..|     ..::||....|.::   |..:.:.:.||:..||
Human   143 KENREANL-----AAIIERLQEKLVKF---ISSELKESIESQFLEL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31642NP_723159.1 ZZ_PCMF_like 15..65 CDD:239078
STMN2NP_001186143.1 Membrane attachment. /evidence=ECO:0000255 1..26
Stathmin 39..163 CDD:307125 25/154 (16%)
Regulatory/phosphorylation domain. /evidence=ECO:0000255 39..96 8/53 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.