DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31523 and elovl1

Sequence 1:NP_001262255.1 Gene:CG31523 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001016644.1 Gene:elovl1 XenbaseID:XB-GENE-1014374 Length:290 Species:Xenopus tropicalis

Alignment Length:291 Identity:127/292 (43%)
Similarity:182/292 (62%) Gaps:9/292 (3%)


  Fly     1 MAIILQEAQKWYRDLMDNKSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRS 65
            |..:|.|..:.|.:.|.. :|.|:.|:.|:.||.....:.:.|.||..|||||:||.|||.:|:.
 Frog     1 MEAVLSEWVQKYHNFMKG-ADSRIYDYPLMQSPFLPGAILLSYVYFVLSLGPRIMANRKPFDLKP 64

  Fly    66 VLVVYNAIQTIFSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDT 130
            ::||||......||:|.||:|||||...|:.:|.|||.|.|.:|:|||.:.|.:..|||.|..||
 Frog    65 LMVVYNFSLVALSAYIVYEFLMSGWLTGYTWRCDPVDVSDTPMALRMVRVAWLFLFSKFIELLDT 129

  Fly   131 LFFILRKKNEHVSTLHVIHHGCMPFSVWMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPK 195
            :||::||||..::.||:.||..:|:|.|.|:||.|||..:|.|::||.||::|||||.::|.||:
 Frog   130 VFFVVRKKNSQITFLHIFHHSVLPWSWWWGVKFGPGGMGSFHAMINSLVHVIMYFYYGLSAAGPR 194

  Fly   196 YQKYIWWKKYLTTFQMVQFVAIFTHQFQLLF-RECDYPKGF---MVWIGLHGVMFLFLFSDFYKA 256
            :|||:||||::|..|::|||.:..|..|..| ..|||....   ::||  :|.:|..|||:|:..
 Frog   195 FQKYLWWKKHMTAIQLIQFVLVSIHISQYYFMSSCDYQYPIFIHLIWI--YGTVFFILFSNFWYQ 257

  Fly   257 KYLNAARRRRQAVKANG--YANGSASNGHSK 285
            .|....|..:.:..|||  :.||.|.||..|
 Frog   258 AYTKGRRLPKGSTVANGALHQNGKAKNGKYK 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 110/241 (46%)
elovl1NP_001016644.1 ELO 27..267 CDD:279492 110/242 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62351243
eggNOG 1 0.900 E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094172at2759
OrthoFinder 1 1.000 FOG0000111
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.