DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31523 and elovl2

Sequence 1:NP_001262255.1 Gene:CG31523 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001016159.1 Gene:elovl2 XenbaseID:XB-GENE-489753 Length:296 Species:Xenopus tropicalis

Alignment Length:288 Identity:108/289 (37%)
Similarity:157/289 (54%) Gaps:25/289 (9%)


  Fly    14 DLMDNKSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFS 78
            |.:....|.|...:.:|.|.||||.:.:.| :.|..||.:.|..|....||..|:|||.:.|:.|
 Frog    16 DYLFGPRDTRTRGWLMLDSYLPTLFLTLLY-FLSIWLGTKYMQNRPAFSLRGHLIVYNLVVTLLS 79

  Fly    79 AWIFYEYLMSGWWGHYSLKCQPVDYSTTGLA-MRMVNICWWYYISKFTEFFDTLFFILRKKNEHV 142
            .::..|.::|.|.|.|:|:||.:|  :.|.| :|:..:.||||.||..||.||:||:|||||..:
 Frog    80 LYMLIELILSTWEGGYNLQCQNLD--SAGKADVRVAKVLWWYYFSKAIEFMDTIFFVLRKKNSQI 142

  Fly   143 STLHVIHHGCMPFSV-WMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYL 206
            :.|||.||..| |:: |..|.:.|.|.|.|...||||:|::||.||.::.: |...||:|||:||
 Frog   143 TFLHVYHHASM-FNIWWCVLNWIPCGQSFFGPTLNSFIHVLMYSYYGLSVI-PSMHKYLWWKRYL 205

  Fly   207 TTFQMVQFVAIFTHQFQLLFRECDYPKGFMVWIGLHGVMFLFLFSDFYKAKYLNAARRRRQAVKA 271
            |..|:|||:...||......:.|.:|.|.:::...:....:.||.:||...|    ::|......
 Frog   206 TQAQLVQFLLTITHTLSAAVKPCGFPFGCLMFQASYMATLVILFVNFYLKTY----KKRPSKSDP 266

  Fly   272 NG------YANG------SASNG--HSK 285
            ||      ..||      :||||  |.|
 Frog   267 NGIPALTEMRNGYHKDLINASNGIQHKK 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 94/239 (39%)
elovl2NP_001016159.1 ELO 31..263 CDD:307345 95/241 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094172at2759
OrthoFinder 1 1.000 FOG0000111
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.