DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31523 and elovl5

Sequence 1:NP_001262255.1 Gene:CG31523 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_956747.1 Gene:elovl5 ZFINID:ZDB-GENE-040407-2 Length:291 Species:Danio rerio

Alignment Length:304 Identity:111/305 (36%)
Similarity:157/305 (51%) Gaps:28/305 (9%)


  Fly    12 YRDLMDNKSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTI 76
            |.|......|.||..:|||...:||....:.|... ..:||:.|..|:....|::||.||...|:
Zfish    11 YIDSWMGPRDLRVTGWFLLDDYIPTFIFTVMYLLI-VWMGPKYMKNRQAYSCRALLVPYNLCLTL 74

  Fly    77 FSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEH 141
            .|.::|||.:||.:.|.|:..||.. :|......||:|:.||||.||..||.||.||||||.|..
Zfish    75 LSLYMFYELVMSVYQGGYNFFCQNT-HSGGDADNRMMNVLWWYYFSKLIEFMDTFFFILRKNNHQ 138

  Fly   142 VSTLHVIHHGCMPFSVWMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYL 206
            ::.|||.||..|....|..:.:.|.|||.|.|..|||:|::||.||.::|: |..:.|:|||||:
Zfish   139 ITFLHVYHHATMLNIWWFVMNWVPCGHSYFGATFNSFIHVLMYSYYGLSAV-PALRPYLWWKKYI 202

  Fly   207 TTFQMVQFVAIFTHQFQLLFRECDYPKGFMVWIGLHGVMFLFLFSDFYKAKYLNAARRRRQAVKA 271
            |..|:||||.........:...|.:|.|::.:...:.|..:.|||:||...|     ::|...:.
Zfish   203 TQGQLVQFVLTMFQTSCAVVWPCGFPMGWLYFQISYMVTLILLFSNFYIQTY-----KKRSGSRK 262

  Fly   272 NGYANGSASNGHSKHLGEGDALIANGCNTGACMPVMEDEYVKSK 315
            :.|.|||. |||:           ||        ||..|.:|.:
Zfish   263 SDYPNGSV-NGHT-----------NG--------VMSSEKIKHR 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 92/237 (39%)
elovl5NP_956747.1 ELO 27..262 CDD:279492 93/243 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094172at2759
OrthoFinder 1 1.000 FOG0000111
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.