DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG10553

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651383.1 Gene:CG10553 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster

Alignment Length:421 Identity:141/422 (33%)
Similarity:229/422 (54%) Gaps:12/422 (3%)


  Fly     2 PDNSNKFSASSDVRIPAWINEAYFKRLLKREFREFRRILNLSIIPATPPGETYTSLLMRIVIDIE 66
            |...::..:...|.||.|:....|:.||||..::::...::........||.|.::::||.:|:|
  Fly     3 PQTKDEDVSQKQVTIPDWVKPTVFEELLKRIVKDYKATKSMRANAGVAAGENYATVMLRIELDVE 67

  Fly    67 LKDGFSQQKSYIVKTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCH 131
            .:|.....|::::||.....|.. ..:...:||..|:.||..::|.|||||.:.||.|||..:.:
  Fly    68 KEDNTQTTKAFMLKTPHQSEQYR-KVIEKTDIFDVERGMYVEVVPELEQLYRDVGLEVKFGAELY 131

  Fly   132 HAEDIKGRICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQR 196
            ..|.....:.|  |||:.:.:.||:||:|.|.||...||:|.|::|||.||..:.|||:.:.:.:
  Fly   132 DIEASDYYVLL--EDLRPRGFGNIDRLEGMDQAHTECVLKKFAQWHAASAVRVETKGPYQEKYTK 194

  Fly   197 IYLPANYQKSKSYQARLQSYKTAIASWGLA-DHEQYVS--RIPTADQFVQSYASCFNNNPQEFKV 258
            .:| .|.:...::..|  |.|..:.:..|. .:|.|::  ||.:...| :...|..|.:|.||..
  Fly   195 GFL-RNEEIVDAFINR--SIKVFLDNVHLCKGYETYLNDLRIVSGKTF-EIVESLNNPSPDEFIA 255

  Fly   259 LNHGDFWSSNIMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIY 323
            |||||.|::|||..|...|:|....|||.|:.||||..|||:..::.|....|:...|||||..|
  Fly   256 LNHGDGWANNIMSQYNTKGEIQDTYFVDLQVPKWGSVTQDLYYFLLSSTSLDIKTSKFDYFIWFY 320

  Fly   324 HTHLVRCLKILKYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPDTEASLVKLTQPGEEG 388
            |:.||:.||:|.||:.:|.||.::.::.||..|.:..|.|.|.::||.|...|...|:.  |::.
  Fly   321 HSELVKHLKLLGYSKTLPTLRRINDALNKYSGWSFICTATILAYVLLDPVDGADFDKVL--GDDD 383

  Fly   389 DRFRSKVYTNPLYVRSALSIFPFLLRRGILD 419
            ..|::.:|.||.:.:....:.|:|..||.::
  Fly   384 CSFKNSLYINPRFRKHMEVLLPWLQHRGAME 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 106/289 (37%)
CG10553NP_651383.1 EcKinase 52..333 CDD:281023 106/288 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131024784
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4024
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.