DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31102 and CG10559

DIOPT Version :9

Sequence 1:NP_001262951.1 Gene:CG31102 / 326118 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster


Alignment Length:422 Identity:129/422 - (30%)
Similarity:214/422 - (50%) Gaps:41/422 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IPAWINEAYFKRLLKREF-------REFRRILNLSIIPATPPGETYTSLLMRIVIDIELKDGFSQ 73
            :|.|:....|:.||.:.:       :.|:....|.      |||.|:::::|:.:::||:|...:
  Fly    10 MPTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLK------PGENYSTIMLRLKLEVELQDHTIE 68

  Fly    74 QKSYIVKTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHAEDIKG 138
            ..||::||.. |.:.....:...|:|..|:.::..:||.|||:|::.|:.|||..|.:..:....
  Fly    69 NVSYMLKTPY-DFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKAYEIDAPDD 132

  Fly   139 RICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANY 203
            .:.|  :||....:||::||:|.||.|...||:|:|::||..|.....|||:|.:    ||...|
  Fly   133 YVLL--QDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQN----YLQPTY 191

  Fly   204 QKSKSYQARLQSYKTAIASWGL------ADHEQYVSRIPTADQFVQSYASCFNN-NPQEFKVLNH 261
              :.:.:..::.....:..:.|      ..:|:|.:.:......:.......|. :||:|..|||
  Fly   192 --ADTMKESIEQVAETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAMNTPDPQDFNALNH 254

  Fly   262 GDFWSSNIMLSY-TQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHT 325
            ||.|:||||..| .::.:..:..|||.||.|..|.|.||...::.|.:..|::..|||||:.||.
  Fly   255 GDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHD 319

  Fly   326 HLVRCLKILKYSE-RIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPP-----DTEASLVKLTQP 384
            |||..|::|.|.| :.|.|..||..::|||..||     |:.|||.||     ..:|:|......
  Fly   320 HLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGY-----HIAFILCPPVLLDRTEDANLTDFVTE 379

  Fly   385 GEEGDRFRSKVYTNPLYVRSALSIFPFLLRRG 416
            .:.||..:..:|:|..|.:...:|..:|..||
  Fly   380 TDNGDGLKLAMYSNARYKKHVSAILKWLNNRG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 94/293 (32%)
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 94/293 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I6344
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.