DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG10550

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster

Alignment Length:424 Identity:176/425 (41%)
Similarity:259/425 (61%) Gaps:11/425 (3%)


  Fly     2 PDNS--NKFSASSDVRIPAWINEAYFKRLLKREFREFRRILNLSIIPATPPGETYTSLLMRIVID 64
            |:||  ...:.:..:.||.||||.||:.:::::...|.:|:||..|.||.|||.|||:::|:::|
  Fly     3 PNNSAEKPVNPNEHLHIPKWINEEYFQPIIEKDVENFDKIINLVPIAATAPGENYTSIMIRVIVD 67

  Fly    65 IELKDGFSQQKSYIVKTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPK 129
            |.||||..|:.|||:|||| :|......::.:.:||||:.|||..||...:||:||||.::.|||
  Fly    68 ILLKDGSEQRVSYILKTML-EADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPK 131

  Fly   130 CHHAEDIKGRICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDF 194
            |.|.:.....|.:|.|||..:.::|.:||||||:.||..||.||||.|||..|.::..||:...:
  Fly   132 CLHVDATDELITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMY 196

  Fly   195 -QRIYLPANYQKSKSYQA----RLQSYKTAIASWGLADHEQYVSRIPTADQFVQSYASCFNNNPQ 254
             ..||   |.|....:::    |.:.:..|:.:|.|.:.|.|::|:....:..:........:..
  Fly   197 NMSIY---NEQSRDLFESLGKQREEQFLKAMRNWDLENAESYIARMWDPLEVFEEAVQVNQVDED 258

  Fly   255 EFKVLNHGDFWSSNIMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYF 319
            ||.||||||.||:|||.:|...|:|::...||.|:.||||||||||.||..||...|:|:.||:|
  Fly   259 EFNVLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHF 323

  Fly   320 IRIYHTHLVRCLKILKYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPDTEASLVKLTQP 384
            |:|||..|..|||:|.||:.||.||:||:.|:||||||..|....:|..|:|.|.:|::..:...
  Fly   324 IQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGVMVATLMPTDKDANMKMILAQ 388

  Fly   385 GEEGDRFRSKVYTNPLYVRSALSIFPFLLRRGIL 418
            |.|.|..|.:.:.||.|.::...:.||...:|:|
  Fly   389 GPEADAIRYRTFINPYYAKAMKVLLPFFDNKGLL 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 126/291 (43%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 126/291 (43%)
APH 108..338 CDD:279908 98/233 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131024452
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4024
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.