DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG31097

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_733093.2 Gene:CG31097 FlyBaseID:FBgn0051097 Length:420 Species:Drosophila melanogaster

Alignment Length:413 Identity:155/414 (37%)
Similarity:235/414 (57%) Gaps:15/414 (4%)


  Fly    16 IPAWINEAYFKRLLKREFREFRRILNLSIIPATPPGETYTSLLMRIVIDIELKDGFSQQKSYIVK 80
            :|.|:|::.|:.|:.::..:|.:|...:.:.|.|||..:.|:::|:.:||.:|||..::|||:||
  Fly    12 VPKWLNKSKFESLIAKDEPDFTKIDQFTTVAAVPPGGNFASVMLRVYLDIVMKDGSQKRKSYVVK 76

  Fly    81 TMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHAEDIKGRICLVQE 145
            |||:..:| |..||.:..|.||:.||.|.:|..|::|..||..|:..|||....:|.|.|..:.|
  Fly    77 TMLESDKG-GKAVNEMRYFHKEQQMYSTYLPQFEKIYRVAGHPVQLMPKCLEIGEIDGNIYFIFE 140

  Fly   146 DLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSK--- 207
            ||.|:.:...:|.||.:|.||...|.||||.|||..::::|.||:..||...:.    :|.|   
  Fly   141 DLSTRNFVAADRTKGVNMEHMRLSLRKLAELHAASVIYKERYGPYHADFDNGFA----RKDKIEH 201

  Fly   208 ---SYQARLQSYKTAIASWGLADHEQYVSRIPTADQFVQSYASCFNNNPQEFKVLNHGDFWSSNI 269
               .::.:...||.|:.:||:  .|.|:...||.:|:.:......|.:||:|.||.||||..|||
  Fly   202 SVRRFEVKAPEYKAAMKTWGI--DECYLKNFPTTEQYGKLCLESLNVDPQDFNVLTHGDFSPSNI 264

  Fly   270 MLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVRCLKIL 334
            :..|.:.|..::...:|||:|||.||.|||..|||.|||.....:.||..:|||..:|:..|::|
  Fly   265 LFKYNENGAPSEALILDFQICKWASPTQDLLMLIILSARKDSSYKEFDNIVRIYWEYLIDFLRVL 329

  Fly   335 KYSERIPMLRELHMSMIKYG--FWGYFTTFTHLVFILLPPDTEASLVKLTQPGEEGDRFRSKVYT 397
            ||.:.:|.||||..::.|..  |..:|....||...|||...|.:|.......|.|..||:||||
  Fly   330 KYKKPLPQLRELQSAIYKKNNTFSAFFAVMNHLPGDLLPVCKENNLHTFNLEDEVGKSFRTKVYT 394

  Fly   398 NPLYVRSALSIFPFLLRRGILDF 420
            ||::|.....::|....||:.:|
  Fly   395 NPIFVEVVKELYPICCNRGLFNF 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 115/292 (39%)
CG31097NP_733093.2 EcKinase 46..331 CDD:281023 115/292 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131024415
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4024
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.