DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG31098

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_733091.1 Gene:CG31098 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster

Alignment Length:438 Identity:108/439 (25%)
Similarity:194/439 (44%) Gaps:57/439 (13%)


  Fly     9 SASSDVRIPAWINEAYFKRLLKREFREFRRILNLSIIPATPPGET---YTSLLMRIVIDIELKDG 70
            :.|.:.:.|.|:...:.:.:||..|:|.:..:...|:.:...|:.   :.|.:.|...:::....
  Fly     3 TGSKNYQAPEWLTAEFLQDVLKEHFKEEQLAVTELIVKSAQVGDQAAGFASEMHRASFNLQRGTA 67

  Fly    71 FSQQKSYIVKTMLDDAQGNGGFV-NTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHAE 134
            ...:.|.|||   |..:|..|.| :...:|.:|.:.|:.::|.::.|.:..|...|.||.|::..
  Fly    68 PKGKFSVIVK---DHPKGQTGAVAHRSKLFKREILAYKEVLPRIQALLQSIGDQTKIAPTCYYTT 129

  Fly   135 DIKGRICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQ-------------- 185
            : .....|:.||:|...:.|..|.:..::.::...:||:|:.||..|:..|              
  Fly   130 E-SPEPFLILEDMQLSGFENFERGRLLNLDYVLPTIEKVAKLHACSALIAQDSPEVLEFFDEAPI 193

  Fly   186 RKGPFPDDFQRIYLPANYQKSKSYQARLQSYKTAIASWGLADHEQYVSRI-PTADQFVQSYASCF 249
            .:.|...|| ..:.|.|          ::.....:|.|  ..:|:...:: ..|:..:|...:.|
  Fly   194 SRNPDRRDF-LTFFPVN----------IRCVAEEVAHW--KGYEEITEKMFNLAENVLQRALTMF 245

  Fly   250 NNNPQEFKVLNHGDFWSSNIMLSY-TQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRI 313
            .:..::|:|.|..|.|.:|::... .:|.:.:.|..:||||...|||..||...:..|...::|.
  Fly   246 ESTGKDFRVFNLTDLWINNLLFHINNETKEPDDVVTLDFQLAYVGSPTIDLNYFLYGSLNENVRK 310

  Fly   314 QYFDYFIRIYHTHLVRCLKILKYSERIPMLRELHMSMIKYGFWGYF--TTFTHLVFILLPPDTEA 376
            .::.|.:|.|...|.:.|:.|.|...||.|:|:|:.:||....|..  |..|.|:|      .|.
  Fly   311 VHYKYIVREYQRVLQQTLEKLNYQGHIPTLKEIHIELIKTSLMGVIGATCLTPLIF------REG 369

  Fly   377 ----SLVKLTQPGEEGDRFRSKVYTNPLYVRSALSIFPFLLRRGILDF 420
                :|..|....|.|||||.:...||.| |:       .|:|.|.:|
  Fly   370 AGFENLEDLNSRTESGDRFRRENVENPKY-RA-------FLQRTIKEF 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 70/306 (23%)
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 69/300 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4024
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.