DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG11893

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651375.1 Gene:CG11893 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster

Alignment Length:447 Identity:106/448 (24%)
Similarity:184/448 (41%) Gaps:93/448 (21%)


  Fly     1 MPDNSN--KFSASSDVRIPAWINEAYFKRLLKREFREFRR-----ILNLSIIPATPPGETYTSLL 58
            ||:|::  :|:| .::..|||:|..:...:|    |.:.:     :.:|.|.||:..|:.|.|::
  Fly     1 MPENADTEQFNA-DELEAPAWLNAQFITDVL----RTYEKCPELEVTDLKITPASAQGDHYASVM 60

  Fly    59 MRIVIDIELKDG-FSQQKSYIVKTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGL 122
            .|...:.....| |.  |..|:|||.:........::..::|..|...|...:|..|::..|||.
  Fly    61 FRTTAEYTTSKGKFC--KPLIIKTMPEQEGHKKDMLSDSHLFSTEINAYTKALPEFERILREAGD 123

  Fly   123 SVK-FAPKCHHAEDIKGRICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQR 186
            ..| |.|..:|:  ::.|..|:.|||..:.|..| |.:..:|.....|..|||::||........
  Fly   124 DTKLFVPCIYHS--LEPRQVLIFEDLVPQGYFVI-RDRPINMNEYKNVFSKLAKWHAVSMKVLNE 185

  Fly   187 KGPFPDDFQ--RIYLPA------------NYQKSKSYQARLQSYKTAIASWGLADH-----EQYV 232
            :.....||:  .:.:|:            |:.|.......|..||         .|     |.|:
  Fly   186 QPDILKDFKYGLMEMPSIMSDPMVTTGMDNFLKMMDQIPELTKYK---------PHFEKIKENYI 241

  Fly   233 SRIPTADQFVQSYASCFNNNPQEFKVLNHGDFWSSNIMLSYTQTGDINQVRFVDFQLCKWGSPAQ 297
            .|:   ...:|.|..  |.....:.|:.||||...|:|.:..:     :|.|||||:|.      
  Fly   242 QRM---GDVMQEYRK--NVQSDGYYVMCHGDFHGRNMMFNKNE-----EVMFVDFQICN------ 290

  Fly   298 DLWELIICSARHSIRIQYFDY--------------FIRIYHTHLVRCLKILKYSERIPMLRELHM 348
                  :|..  :|.:.|..|              .|..|.:.|...||.:.|..::|....|..
  Fly   291 ------LCPI--TIDLSYSVYMLMEPEQRWDLGKDLINFYFSVLEDTLKKVGYKGKMPTNDGLWK 347

  Fly   349 SMIKYGFWGYF--TTFTHLVFILLPPDTEASLVKLTQPGEEGDRFRSKVYTNPLYVR 403
            .:.::.|:.:|  |||:.::..:     :|:..|:.:..::.: .|.|.|....||:
  Fly   348 QIHRHKFYDFFLLTTFSPMIVAV-----KANTFKIHELIQDPE-IRQKSYLYDPYVQ 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 76/321 (24%)
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 76/321 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55449
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.