DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG31104

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster

Alignment Length:423 Identity:97/424 (23%)
Similarity:172/424 (41%) Gaps:50/424 (12%)


  Fly    11 SSDVRIPAWINEAYFKRLLKREFREF--RRILNLSIIPATPPGETYTSLLMRIVIDIELKDG--F 71
            :.:::.|||:|..:...:| ||:.:.  .::.:|.:.|||..|:.|.|::.|..::.....|  |
  Fly    10 ADELQAPAWLNAQFIGDIL-REYEQLPDLKVTDLQVSPATAQGDHYASVMFRTKVEYTTPKGKFF 73

  Fly    72 SQQKSYIVKTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVK-FAPKCHHAED 135
               |..|:|||.:........::..::|..|..||...:|..|::..|||.:.| |.|..:|:  
  Fly    74 ---KPLIIKTMPEQEGHKKDMLSESHLFETEIGMYCHALPEFERILREAGDNTKLFVPCIYHS-- 133

  Fly   136 IKGRICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQ--RIY 198
            :|.|..::.|||..:.| .:.|.....:..:....:|||::||........:..|..:||  ...
  Fly   134 LKPRQVMIFEDLVPQGY-TVIRDSPPSLGDLKLAFDKLAKWHAVSMKVINEQPYFLKEFQYGLFE 197

  Fly   199 LP------------ANYQKSKSYQARLQSYKTAIASWGLADH-----EQYVSRIPTADQFVQSYA 246
            :|            .|:.:.......|:.||         .|     :.|:.|:...   :..|.
  Fly   198 MPTIDTDPFITTGMTNFIEMLDKMPELRKYK---------HHFEKIKDNYMQRLEVE---MHEYH 250

  Fly   247 SCFNNNPQEFKVLNHGDFWSSNIMLSYT-QTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHS 310
            ....|:  .:.||.||||...|:|..:. :.|..:.|..|||||........||...:.......
  Fly   251 KYRRND--RYYVLCHGDFHLRNMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLTYSVYMLMEPE 313

  Fly   311 IRIQYFDYFIRIYHTHLVRCLKILKYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPDTE 375
            .|.:..:..|..|.:.||..|:.:.|...:|..|||...:....::.:|...|.|..::.....:
  Fly   314 QRWEMGENLINEYFSVLVATLRKIGYKGDMPTQRELWEQIQNNKYYDFFLISTFLPIMVGVKSND 378

  Fly   376 ASLVKLTQPGEEGDRFRSKVYTNPLYVRSALSI 408
            ..:.:..|..:.    |.|.|....||:....:
  Fly   379 LKMHEALQDSQA----RLKSYFLDDYVQDVYKL 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 72/309 (23%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 72/309 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55444
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.