DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG11878

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651369.1 Gene:CG11878 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster

Alignment Length:412 Identity:113/413 (27%)
Similarity:191/413 (46%) Gaps:15/413 (4%)


  Fly    17 PAWINEAYFKRLLKREFREFR-RILNLSIIPATPPGETYTSLLMRIVIDIELKDGFSQQK-SYIV 79
            |.|:...|.:..|:..|::.. ::..|...||...|..|.|::.||.::...|....:|. :::|
  Fly    13 PVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTKVSKGKQSTTFLV 77

  Fly    80 KTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNL-EQLYEEAGLSVKFAPKCHHAEDIKGRICLV 143
            ||...|....|..:....::.:|..:||.|:|.| :.:.:|...|.|......:.:  :.|..::
  Fly    78 KTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAATMNVD--RERDSII 140

  Fly   144 QEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSKS 208
            .||:....|:...|.|..|:.|.|.||||||.||||.:|..:|:   |..|.:.|....:.|...
  Fly   141 FEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQ---PGIFDKNYDRGFFNKHTR 202

  Fly   209 YQARLQSYKTAIASWGLADHEQ----YVSRIPTADQFVQSYAS-CFNNNPQEFKVLNHGDFWSSN 268
            ..|.:.:......|..||..|:    |.::|....:.:..|.. ...::|.:|..|.|||.|::|
  Fly   203 AYAPIMTNLLEALSRSLASDEELGQRYKAKIDRLVERLMDYGERSTTSSPGDFLTLAHGDLWTTN 267

  Fly   269 IMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVRCLKI 333
            .|..|..........|:|||...|.|||.||......|.:.::|:::....::.|:..|...|:.
  Fly   268 FMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEHQTELVQFYYYRLTEALRK 332

  Fly   334 LKYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPDTEASLVKLTQPGEEGDRFRSKVYTN 398
            |||:.|||.|.:..:.....||:..|.:......:......:||:.::....|.|.||::.||.:
  Fly   333 LKYAGRIPSLFDFQLQFRSRGFYAVFCSLIFEPVMQYEGKEDASIEQVLSSSESGMRFKNSVYES 397

  Fly   399 PLYVRSALSI-FPFLLRRGILD 419
            . .::..||: .|||.:.|:||
  Fly   398 E-NIKKKLSVTLPFLDQFGLLD 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 81/293 (28%)
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 81/293 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55751
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.