DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG14314

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster

Alignment Length:341 Identity:79/342 (23%)
Similarity:141/342 (41%) Gaps:61/342 (18%)


  Fly    51 GETYTSLLMRIVIDIELKDGFSQQKSYIVKTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQ 115
            |:.||:.|.||.:..: :.....:::.|.|.|.:.......:.:. .:|..|...|.||:|.|  
  Fly    56 GDNYTAALYRIKLTGK-RRSLKWEQNVICKVMPESVVAREAYKSD-KLFRNEVQFYNTIMPEL-- 116

  Fly   116 LYEEAGLSVKF--------------APKCHHA-EDIKGRICLVQEDLQTKKYRNINRLKGFDMAH 165
                    :||              .|||:.| .|:     |:.|||:.:.::..:|.||..:..
  Fly   117 --------LKFQASKTNQDTPVFNAIPKCYSARHDL-----LIMEDLRERGFQMSDRHKGLSLEE 168

  Fly   166 MHRVLEKLAEFHAAGAVWRQRKGPFPDDF--------QRIYLPANYQKSKSYQARLQSYKTAIAS 222
            ...||.::|:.|.....::..|   |.:|        :.|:..||....::|..||......:.|
  Fly   169 TQSVLLQVAQLHGLSLAYKFEK---PLEFSNLCSMISEGIFCTANTSWYRNYYERLTKNAIQMVS 230

  Fly   223 WGLADHEQYVSRIPTADQFVQSYASCFN------NNPQEFKVLNHGDFWSSNIMLSYTQTGD--I 279
            ..|....:||..:   ::|.:| :|.|.      :.......:.|||.|.:|.:..|.....  :
  Fly   231 EVLPPDSKYVLAM---NKFAES-SSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRV 291

  Fly   280 NQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVRCLKIL-----KYSER 339
            .:|..:||||.::.|.|.|:..|:.|.....:|.......::||...|.|.|::|     .:.:.
  Fly   292 LEVALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDT 356

  Fly   340 IPMLRELHMSMIK-YG 354
            :..|::|....:| ||
  Fly   357 LQKLQDLFAEELKTYG 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 74/321 (23%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 73/314 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4024
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.