DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG6908

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_650105.1 Gene:CG6908 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster

Alignment Length:413 Identity:145/414 (35%)
Similarity:224/414 (54%) Gaps:22/414 (5%)


  Fly    16 IPAWINEAYFKRLLKREFREFRRILNLSIIPATPPGETYTSLLMRIVIDIELKDGFSQQKSYIVK 80
            ||||:::..|:.:|:|:|.:.::|.:..:.|....||.||:||:|...::||.||..|..||:.|
  Fly    47 IPAWLDQQKFEPILERDFPDLKKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYMAK 111

  Fly    81 TMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHAEDIKGRICLVQE 145
            .:.:  .||...|.:..:|.||:..|...||..||:|::||..:.|.|:.:.::.......:|.|
  Fly   112 ILPN--SGNRENVASWKVFYKERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQIELDDELIVLE 174

  Fly   146 DLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSKSYQ 210
            ||..:.:||::|..|.|:.|....|||||:||||.||..:.||.:|:::.:..........:..:
  Fly   175 DLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVVDSLKELRE 239

  Fly   211 ARLQSYKTAI----ASWGLADHEQYVSRIPTADQFVQSYASCFNNNPQEFKVLNHGDFWSSNIML 271
            .:|::|..|.    ||....|.:.|.|:   ||...||:|.....   ||:||||||.|.:|||.
  Fly   240 NQLKAYIDAFPLYDASHLTNDVQAYGSQ---ADDMFQSFAPKIEG---EFRVLNHGDAWCNNIMY 298

  Fly   272 SYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVRCLKILKY 336
            .|.:.|.:.:|.|||.|:.::.||||||..||:.|....|:|..|||.|:.||..|:..||:|||
  Fly   299 QYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKY 363

  Fly   337 SERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLP-----PDTEASLVKLTQPGEEGDRFRSKVY 396
            .:.:|.||.||.|:..||.|     ...:|.||||     ...:|::..|......||:.|:.::
  Fly   364 PKPLPSLRSLHQSIFIYGDW-----ILPIVSILLPLVLIDGGDDANMDSLMDGEGAGDKIRNNMF 423

  Fly   397 TNPLYVRSALSIFPFLLRRGILD 419
            .|...::....|.|:..|||..:
  Fly   424 KNHRVIKHQKEILPWAHRRGAFE 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 109/290 (38%)
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 109/290 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131024533
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4024
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.