DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG13813

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_649195.1 Gene:CG13813 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster

Alignment Length:412 Identity:77/413 (19%)
Similarity:160/413 (39%) Gaps:68/413 (16%)


  Fly    46 PATPPGETYTSLLMRI----VIDIELKDGFSQQKSYIVKTMLDDAQGNGGFVNTLNIFPKEKMMY 106
            |....||.....::|:    ::|          .:.:|..|....:.....::.::.:.:|..||
  Fly    29 PMAGVGENAYGQVLRVSWPTIVD----------AATVVVKMAPRNEARRSHMHVVDYYAREVFMY 83

  Fly   107 ETIIPNLEQLYEEAGLSVKFAPKCHHAEDIKG-RICLVQEDLQTKKYRNINR--LKGFDMAHMHR 168
            :.:.|....|..:.. :...||.. .|.|:|. ...|:.|||....:|..:|  :..:|:.... 
  Fly    84 QKVFPVFRALSPDRN-TFTVAPAL-QANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVVCS- 145

  Fly   169 VLEKLAEFHAAGAVWRQ--------------RKGPFPDDFQRIYLPANYQKSKSYQARLQSYKTA 219
             |:.|||.||...:.:|              :...|..|.:.:.:  .:.|::..:||:...:  
  Fly   146 -LKALAELHACSFILQQTDPLQFKQLVEFVEKDNLFTSDIEEVTI--EFGKAQLRKARIILKE-- 205

  Fly   220 IASWGLADHEQYVSRIPTADQFVQSYAS-----CFNNNPQ-EFKVLNHGDFWSSNIMLSYTQTGD 278
                  :|.:| |:.:....|..::...     |.:...| ...|:.|||||::||:..:....|
  Fly   206 ------SDGDQ-VAAVQEVLQLCENQLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHEPNSD 263

  Fly   279 IN-QVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVRCLKILKYS-ERIP 341
            .. :.:.:|||:.::..|..|:...:.......:|.::|..|:..|:..:.:.||....| |.|.
  Fly   264 QPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIY 328

  Fly   342 MLRELHMSMIKYGFWGYFTTFTHLVFIL------LPPDTEASLVKLTQPGEEGDRFRSKV----- 395
            .....:..:.:||.:|.......|.|.:      :..||.:..::......:..:::..:     
  Fly   329 PRSVFNRQLQQYGVYGLIMGAFSLPFFISNANEVIDIDTVSEAIQSISTSSDEPKYKELIEEYEM 393

  Fly   396 ---YTNPLYVRSALSIFPFLLR 414
               .|.|::.|....|...|::
  Fly   394 LNARTLPIFKRRITGIVEDLIK 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 61/314 (19%)
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 61/312 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59490
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.