DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG5644

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_648274.1 Gene:CG5644 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster

Alignment Length:512 Identity:96/513 (19%)
Similarity:172/513 (34%) Gaps:186/513 (36%)


  Fly     3 DNSNKFSASSDVRIPAWINEAYFKRLLKREFREFRRILNLSIIPATPPGETYTSLLMRIVIDIEL 67
            |.:|::..          |..:.::|..:.......|.:::....:..|:.|.|::.|:.|....
  Fly    27 DGTNQYEE----------NAEHLRQLFSQSKLVSFSIAHIACSAGSSSGDNYMSVVKRVTISQAG 81

  Fly    68 KD-----GFSQQKSYIVKTML-----------DDAQGNGGFVNTLNIFPKEKMMYETIIPNL--- 113
            ||     ..|:..:.|||..:           ::|     |.|.:|       .|..:.|.|   
  Fly    82 KDQDPELAGSEIVTVIVKRQIASLSRRQLYRCEEA-----FSNEIN-------AYRHLAPLLAAH 134

  Fly   114 --EQLYEEAGLSVKFAPKCHHAE-----DIK-GRICLVQEDLQTKKYRNINRLKGFDMAHMHRVL 170
              .||:          |.||.||     |.: |...:|.:||:...:|..:||.|.:::....|:
  Fly   135 SRHQLF----------PVCHIAESQDRRDAEGGEPIIVLQDLKAMGFRMKDRLAGLELSDCLLVM 189

  Fly   171 EKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSKSYQARLQSYKTAIASWGLADHEQYVSRI 235
            :|||:.|||.                  |.|...:|.|:                |.|..::..|
  Fly   190 KKLAQLHAAS------------------LAAQELESSSF----------------AFHADHLQEI 220

  Fly   236 PTADQFVQSYASCFNNNPQEF-------------------------------------------K 257
            ...|:....||:..:.:.|:.                                           .
  Fly   221 VYCDEATDFYATILDTSVQQALESLGDANADDCLTTPIRLLEELRTNLFENLKHEINATAAAPNS 285

  Fly   258 VLNHGDFWSSNIMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRI 322
            |:.|||.|.:|||.    ..:..:|.|.|.|..:..||..|:...|..|.|..:|..:.|..:..
  Fly   286 VICHGDLWVNNIMF----RSEPEEVIFFDLQAMRKSSPIFDILHFIYTSTRRPLRDVHTDTLLAA 346

  Fly   323 Y----HTHLVRCLKILKYSERIPML--------------RELHMSMIKYGFWGYFTTFTHLVFIL 369
            |    ...|...|:....:||:..|              |::|.. :..|.|            :
  Fly   347 YSQALSEELRHQLEDTTAAERLEELCEAFSLQRLSSDYVRQVHYG-LAIGMW------------I 398

  Fly   370 LP-----PDTEASLVKLTQPGEEGDRFR-SKVYTNPLYVRSALSIFPFLLRRGILDF 420
            ||     |:...:|..:::....|...: :::.|:..::|         :|..:::|
  Fly   399 LPAVTFDPNNLPNLDVMSEQNLTGKEIKCTQMLTSEYHMR---------IRELVMEF 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 75/360 (21%)
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 74/352 (21%)
P-loop_NTPase <357..435 CDD:304359 14/91 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.