DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG11889

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster

Alignment Length:418 Identity:118/419 (28%)
Similarity:197/419 (47%) Gaps:27/419 (6%)


  Fly    17 PAWINEAYFKRLLKREFR-EFRRILNLSIIPATPPGETYTSLLMRIVIDIELKDG-FSQQKSYIV 79
            |||:.|.|.::.|:..|: :...:..|:|.|||..||.|.|::.||.::...||. .:|..::::
  Fly    10 PAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITKDSKDNQSATFLL 74

  Fly    80 KTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHAEDI-------- 136
            ||...|.......:....|:.:|..|||.|:|.|..:.:.         :.|.:..:        
  Fly    75 KTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKN---------ELHDSRKLFAATVGVD 130

  Fly   137 KGRICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPA 201
            :.|..::.|||..::|:...|:|..|:.|.:.||||||:||||||...||:   |..|::.|...
  Fly   131 RERDSIMFEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQ---PGIFEKNYDRG 192

  Fly   202 NYQKS-KSYQARLQSYKTAIA-SWGLAD--HEQYVSRIPTADQFVQSYASCFNN-NPQEFKVLNH 261
            .:.|. :.|:..:::...|:: :..|:.  .|:|.::|......|..|.....: .|.:|..|.|
  Fly   193 FFNKHVRGYEPIMKNILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERSTSVAPGDFVTLAH 257

  Fly   262 GDFWSSNIMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTH 326
            ||.|::|:|..|...|......|:|||...|.|||.||......|...::|::.....::.|...
  Fly   258 GDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYFYK 322

  Fly   327 LVRCLKILKYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPDTEASLVKLTQPGEEGDRF 391
            ||..|:.:|||.::|.|.|........||:..|.:......::.....|.|:.:.....|:|.|.
  Fly   323 LVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTSDEKGVRL 387

  Fly   392 RSKVYTNPLYVRSALSIFPFLLRRGILD 419
            |..||.....::......|||.:.|:||
  Fly   388 RDAVYQTEENLKKLHLTLPFLDQLGLLD 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 84/300 (28%)
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 84/300 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55749
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.