DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG16898

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_611452.2 Gene:CG16898 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster

Alignment Length:430 Identity:116/431 (27%)
Similarity:195/431 (45%) Gaps:52/431 (12%)


  Fly    16 IPAWINEAYFKRLLKREFREFR-RILNLSIIPATPPGETYTSLLMRIVIDIELKDGFSQQKSYIV 79
            :|.|:.|.|.:..|:..:::.: :::.:...|||..|:.|.||:.||.::|:..||..|.::||:
  Fly     2 LPNWLTEEYLQPKLRAYYKDDQLKVVKVWAKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYII 66

  Fly    80 KTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHAEDI---KGRIC 141
            |..|.:...........:::.:|..|||.|:|.:.:|.:|.||:.||.     |:.|   :....
  Fly    67 KESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVGLTGKFT-----ADTIFVDREYRT 126

  Fly   142 LVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQR------KGPFPDDFQRIYLP 200
            ::.|||....|.|.:|:|..|:||....||.||:||||..|.:||      |..|...|.|    
  Fly   127 IILEDLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKSLFIHCFSR---- 187

  Fly   201 ANYQKSKSYQARLQSYKTAIASWGLADHEQ------YVSRIPTADQFVQSY-ASCFNNNPQEFKV 258
                .:|.|   .:.|:..::::....:||      |.:::....:.:..| |..|....||...
  Fly   188 ----DNKGY---TEVYEGVLSAFIRFINEQPVLKKKYGNKLQKIHENIMDYGARTFEVGEQELLT 245

  Fly   259 LNHGDFWSSNIMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIY 323
            |:|||.|::|.:..|....:......:|||...:.||..||.:....|.|..:: ......:..|
  Fly   246 LSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRDEVQ-DMESVLVEKY 309

  Fly   324 HTHLVRCLKILKYSERIPMLRELHMSMIKYGFWGYFTT--FTHLVFILLPP-----DTEAS--LV 379
            ::.|...:..|.|....|.|:         ||...|.:  |..|:..|..|     .||.|  ..
  Fly   310 YSDLKTNVDTLSYKGIFPSLQ---------GFQKQFESRRFMCLLAHLFKPVIIYDGTEVSSDFS 365

  Fly   380 KLTQPGEEGDRFRSKVYTNPLYVRSALSIFPFLLRRGILD 419
            .:.:..|||.||:..:|.|...::||..:...|..:|:|:
  Fly   366 SVYKDTEEGIRFQKAIYANERVLKSATKLLAMLDAKGVLN 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 83/302 (27%)
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 83/302 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55758
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.