DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31102 and CG33509

DIOPT Version :9

Sequence 1:NP_001262951.1 Gene:CG31102 / 326118 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:395 Identity:87/395 - (22%)
Similarity:141/395 - (35%) Gaps:118/395 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YTSLLMR-------IVIDIEL-KDGFSQQKSYIVKTMLDDAQGNGGFVNTLNIFPKEKMMYETII 110
            |.:|.:|       |:.:||| .....||.:.:.|.               :||.||..:|:|:|
  Fly    41 YYALTLRYCHEEEEIIREIELFVKAMPQQSAELSKE---------------SIFQKESWLYDTLI 90

  Fly   111 PNLEQLYEEAGLSVKFAPKCHHAEDIKGRICLVQEDLQTKKYRNINRLKGFDMA--------HMH 167
            ..|:.|     .:||::|.|.::          ::||..  ..|| :||||..|        .:.
  Fly    91 KKLQAL-----SNVKWSPNCVYS----------RKDLMV--LENI-KLKGFTSAGSAELNEVFVK 137

  Fly   168 RVLEKLAEFHAAGAVWRQRK-----GPFPDDFQRIYLPANYQKSKSYQARLQSYKTAIASWGLAD 227
            .:::.:|.||:|..|:..:.     ..:.|:...|.:.:.                  .:|    
  Fly   138 PLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLLEITVDSE------------------IAW---- 180

  Fly   228 HEQYVSRIPTADQFVQSYASCFNNNPQEF-----------------------KVLNHGDFWSSNI 269
               :.:.:......|:|.|....|..|.|                       .||.|.|.|:.||
  Fly   181 ---FTTGLSAVLAVVRSLAKYQGNREQSFIGDKLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNI 242

  Fly   270 MLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVRCLKIL 334
            ......:|   ....:|||.|::..||.||...:..:...|.|.|.....|.:|||:|::.|..|
  Fly   243 FFPPENSG---PALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDL 304

  Fly   335 KYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPDTEASLVKLTQPGEEGDRFRSKVY--- 396
            ...|.:....||..|..::..:|..........:.:|.|...:..|...        ||||.   
  Fly   305 GLEELVISKSELLESYEEFRLFGVVYRAVAATVVKVPTDFITNDFKYVD--------RSKVILSY 361

  Fly   397 --TNP 399
              |||
  Fly   362 MKTNP 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 72/325 (22%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 64/302 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459670
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.