DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG33509

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster

Alignment Length:395 Identity:87/396 (22%)
Similarity:141/396 (36%) Gaps:118/396 (30%)


  Fly    54 YTSLLMR-------IVIDIEL-KDGFSQQKSYIVKTMLDDAQGNGGFVNTLNIFPKEKMMYETII 110
            |.:|.:|       |:.:||| .....||.:.:.|.               :||.||..:|:|:|
  Fly    41 YYALTLRYCHEEEEIIREIELFVKAMPQQSAELSKE---------------SIFQKESWLYDTLI 90

  Fly   111 PNLEQLYEEAGLSVKFAPKCHHAEDIKGRICLVQEDLQTKKYRNINRLKGFDMA--------HMH 167
            ..|:.|     .:||::|.|.::          ::||..  ..|| :||||..|        .:.
  Fly    91 KKLQAL-----SNVKWSPNCVYS----------RKDLMV--LENI-KLKGFTSAGSAELNEVFVK 137

  Fly   168 RVLEKLAEFHAAGAVWRQRK-----GPFPDDFQRIYLPANYQKSKSYQARLQSYKTAIASWGLAD 227
            .:::.:|.||:|..|:..:.     ..:.|:...|.:.:.                  .:|    
  Fly   138 PLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLLEITVDSE------------------IAW---- 180

  Fly   228 HEQYVSRIPTADQFVQSYASCFNNNPQEF-----------------------KVLNHGDFWSSNI 269
               :.:.:......|:|.|....|..|.|                       .||.|.|.|:.||
  Fly   181 ---FTTGLSAVLAVVRSLAKYQGNREQSFIGDKLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNI 242

  Fly   270 MLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVRCLKIL 334
            ......:|   ....:|||.|::..||.||...:..:...|.|.|.....|.:|||:|::.|..|
  Fly   243 FFPPENSG---PALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDL 304

  Fly   335 KYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPDTEASLVKLTQPGEEGDRFRSKVY--- 396
            ...|.:....||..|..::..:|..........:.:|.|...:..|...        ||||.   
  Fly   305 GLEELVISKSELLESYEEFRLFGVVYRAVAATVVKVPTDFITNDFKYVD--------RSKVILSY 361

  Fly   397 --TNP 399
              |||
  Fly   362 MKTNP 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 72/326 (22%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 65/303 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55282
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.