DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG33510

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster

Alignment Length:379 Identity:79/380 (21%)
Similarity:156/380 (41%) Gaps:58/380 (15%)


  Fly    39 ILNLSIIPATPPGETYTSLL---MRIVIDIELKDGFSQQKSYI-VKTMLDDAQGNGGFVNTLNIF 99
            :||.:|:|||    .:|..|   ..:....:|:|....|.|.: ||:::........::..:.:.
  Fly    41 LLNFNIVPAT----EHTGFLGEYFHLYFQYQLEDQKDVQTSRLFVKSVIFQNANMEFYMEKMGLI 101

  Fly   100 PKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHA-EDIKGRICLVQEDLQTKKY-------RNIN 156
            .||..:|: ::..|::..:..     ::.||:.. :|:     .|.::::...|       |.:|
  Fly   102 EKEIKLYD-LLNELKKFSKHV-----WSAKCYFTRKDL-----FVMQNVEDMGYVALPPGTRFLN 155

  Fly   157 RLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKG-PFPDDFQRIYLPANYQKSKSYQARLQSYKTAI 220
            .      ..|..:|:.||..||:...:.:::| ....:|::      :.|..|....::.|.|.:
  Fly   156 E------NQMGPILKSLATLHASSIAYEKQQGKTIGVEFRK------WLKEVSVDPEVEWYTTGL 208

  Fly   221 -ASWGLADHEQYVSRIPTADQFV-QSYASCF-------NNNPQEFKVLNHGDFWSSNIMLSYTQT 276
             |...:|.....|...|.|.::: |....|.       |.:|....|..|.|.|::|:.....:.
  Fly   209 RAVLAVAAIHPDVLDNPEAQEYIAQELPRCLDKVYCMVNPSPVHRNVFVHRDAWNANVFYHKEKP 273

  Fly   277 GDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLV---RCLKILKYSE 338
            .:...: .||||||::..||.|...:...:.....|.:.....|..|:..|.   |.:.:..|.|
  Fly   274 HEERSI-LVDFQLCRYSPPAMDFHLVTYLNLEPFSRKKMIGSLIETYYDALAEEFREMGVNPYQE 337

  Fly   339 RIPMLRELHMSMIKYGFWGYFTTFTHL-VFILLPPDTEASLVKLTQPGEEGDRF 391
            ::.. :|...|:..:..:|  .|:..: ..:|..||.....:|..:| |:..||
  Fly   338 QLSK-QEFEQSLNDFSLFG--ATYNCIAATVLRLPDNYLKNLKDERP-EDFHRF 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 59/311 (19%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 44/208 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55283
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.