DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31102 and CG33511

DIOPT Version :9

Sequence 1:NP_001262951.1 Gene:CG31102 / 326118 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:312 Identity:76/312 - (24%)
Similarity:127/312 - (40%) Gaps:79/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GETYTSLLMRIVIDIELK-DGFSQQKSYIVKTM-------LDDAQGNGGFVNTLNIFPKEKMMYE 107
            ||.|     ::.::.|:| |......:|.:|::       .::.:..|       :|.||..:|.
  Fly    44 GEYY-----KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKG-------VFQKESALYS 96

  Fly   108 TIIPNLEQLYEEAGLSVKFAPKCHHA-EDIKGRICLVQEDLQTKKYRNINRLKGFDMAHMHRVLE 171
            .|:|.:::.     .:.|..|||::: .||     ||.||| |:.||::...:.:.:.|...|||
  Fly    97 QILPKIQKY-----ATKKLYPKCYYSRNDI-----LVLEDL-TQDYRHLRANEYYTLDHYKIVLE 150

  Fly   172 KLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSKSYQARLQSYKTAIA--------SW---GL 225
            .|:|.|||...|.:::.      .:||               :|||..:.        ||   ||
  Fly   151 HLSELHAASIAWEEKEN------VKIY---------------ESYKNVLIELHLDSNNSWYITGL 194

  Fly   226 ADHEQYVSRIP-----TADQFVQSYASCFNNNPQEF--------KVLNHGDFWSSNIMLSYTQTG 277
            .......:|.|     .|..|:|..........:|.        .||.|.|.|..||:..:.:..
  Fly   195 KAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKES 259

  Fly   278 DI--NQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHL 327
            .:  |....|||||.::.||..|:..|:...|...:|...:|..:..|:.:|
  Fly   260 SVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 76/312 (24%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 76/312 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.