DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG33511

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster

Alignment Length:312 Identity:76/313 (24%)
Similarity:127/313 (41%) Gaps:79/313 (25%)


  Fly    51 GETYTSLLMRIVIDIELK-DGFSQQKSYIVKTM-------LDDAQGNGGFVNTLNIFPKEKMMYE 107
            ||.|     ::.::.|:| |......:|.:|::       .::.:..|       :|.||..:|.
  Fly    44 GEYY-----KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKG-------VFQKESALYS 96

  Fly   108 TIIPNLEQLYEEAGLSVKFAPKCHHA-EDIKGRICLVQEDLQTKKYRNINRLKGFDMAHMHRVLE 171
            .|:|.:::.     .:.|..|||::: .||     ||.||| |:.||::...:.:.:.|...|||
  Fly    97 QILPKIQKY-----ATKKLYPKCYYSRNDI-----LVLEDL-TQDYRHLRANEYYTLDHYKIVLE 150

  Fly   172 KLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSKSYQARLQSYKTAIA--------SW---GL 225
            .|:|.|||...|.:::.      .:||               :|||..:.        ||   ||
  Fly   151 HLSELHAASIAWEEKEN------VKIY---------------ESYKNVLIELHLDSNNSWYITGL 194

  Fly   226 ADHEQYVSRIP-----TADQFVQSYASCFNNNPQEF--------KVLNHGDFWSSNIMLSYTQTG 277
            .......:|.|     .|..|:|..........:|.        .||.|.|.|..||:..:.:..
  Fly   195 KAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKES 259

  Fly   278 DI--NQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHL 327
            .:  |....|||||.::.||..|:..|:...|...:|...:|..:..|:.:|
  Fly   260 SVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNL 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 76/313 (24%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 76/313 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55278
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.