DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG5126

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster

Alignment Length:398 Identity:82/399 (21%)
Similarity:145/399 (36%) Gaps:77/399 (19%)


  Fly    54 YTSLLMRIVIDIELKDGFSQQKSYIVKTMLDDAQGNGGFVNTLNI---FPKEKMMYETIIPNLEQ 115
            :.|.|..:.:|:.:.:. .:.:..:||.|    :|...|..:.|.   |..|...|..|:|..|.
  Fly    43 FMSALYTVTLDVVIAER-KRTEVVLVKFM----KGTEEFRESSNSYIQFSNEIFAYAEILPAYEN 102

  Fly   116 LYEEAGLS---VK-FAPKCH-----HAEDI-KGR-ICLVQEDLQTKKYRNINRLKGFDMAHMHRV 169
            :...:.|.   || :.|.|:     |.|.: .|| ..|..:.|:...|:...||. .....:..:
  Fly   103 VLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLALKHLKGDGYQLGPRLT-LRRDQLEAM 166

  Fly   170 LEKLAEFHAAGAVW---------RQRKG----PFPDD-------------FQRIYLPANYQKSKS 208
            :..:..|||.|...         |.|.|    ||...             |.|.|...:.||.:.
  Fly   167 VGLVGPFHALGYATKILQPNVHARLRAGVVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQL 231

  Fly   209 YQARLQSYKTAIASWGLADHEQY-------VSRIPTADQFVQSYASCFNNNPQEFKVLNHGDFWS 266
            .|.....:..||...    .|:|       :.||.|:     |:|.  :.....|....|||:..
  Fly   232 LQGADPGFGAAIERL----REKYFKQPTLLLERIRTS-----SFAE--DQPDSHFATFLHGDYNR 285

  Fly   267 SNIMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVRCL 331
            :|::..|.....::.::.:|||..::.:.|.||...:..:.....|.:.:...:|.||..::..|
  Fly   286 NNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEML 350

  Fly   332 KIL-------KYSERIPML------RELHMSMIKYGFWGYFTTFTHLVFILLPPDTEASLVKLTQ 383
            :::       ...:|:..|      ...:....:|.|:|.......|.::|......|.|.:|.:
  Fly   351 ELVLRRNRNELTDDRVDQLLQEYSFERFNAHFKRYAFYGPMVCMHFLPWLLGTEKDCAELSRLFE 415

  Fly   384 PGEEGDRF 391
            ....|..|
  Fly   416 TDMHGPAF 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 70/336 (21%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 70/327 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.