DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG31974

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster

Alignment Length:358 Identity:83/359 (23%)
Similarity:144/359 (40%) Gaps:63/359 (18%)


  Fly    48 TPPGETYTSLLMRIVIDIELKDGFSQQKSYIVKTMLDDAQGNGGFVNTL--NIFPKEK------M 104
            |.||:.|.|:::.:...|...||..:....|.|.        ....|.|  .||..|:      .
  Fly    33 TKPGDNYGSIMLSVQAKIRSADGGIRDLPLIAKL--------PPLTNDLYWQIFQPERTCITENA 89

  Fly   105 MYETIIPNLEQLYEEAGL-----------------SVKFAPKCHHAEDIKGRICLVQEDLQTKKY 152
            :|:.:.|.|::|..|:|:                 |:.     :.|..:.....||||::.|:.|
  Fly    90 VYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLD-----NRATKVDRDAVLVQENVTTRGY 149

  Fly   153 RNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSKSYQARLQSYK 217
            |..||.:.:::|....:|..||::||.....|.:|....:::.|.|.......|...||..:...
  Fly   150 RPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKFDMNSNIDQAETEIMN 214

  Fly   218 TAIASWGLAD------HEQYVSRIPTADQFVQSYASCFNNNPQEFKVLNHGDFWSSNIMLSYTQT 276
            ..|    |.|      .|:.|:|:.......|::.:..:.:...|..|.|||.|.:|:||.|...
  Fly   215 KEI----LKDIKLVTSDERDVNRVKELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMR 275

  Fly   277 GDIN---QVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVRCLKILKYSE 338
            |:..   :|:.||||:.::||...|:..::..|...::....|..|:.||            |:.
  Fly   276 GEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIY------------YNA 328

  Fly   339 RIPMLRELHMSMIKYGFWGYFTTFTHLVFILLP 371
            .|..||.:::....|.:..:.........:.||
  Fly   329 FIQTLRSVNVDTSNYTYELFLEEVQQTAHVQLP 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 75/320 (23%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 79/331 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59300
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4024
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.