DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG31300

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster

Alignment Length:419 Identity:99/420 (24%)
Similarity:166/420 (40%) Gaps:42/420 (10%)


  Fly    13 DVRIPAWINEAYFKRLLKR-EFREFRRILNLSIIPATPPGETYTSLLMRIVIDIELKDG-FSQQK 75
            ::..|||:|..:.:.:|.. |.....::::|.|.||:..|:.|.|::.|...:.....| ||  :
  Fly    14 ELEAPAWLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECTTAKGKFS--R 76

  Fly    76 SYIVKTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVK-FAPKCHHAEDIKGR 139
            ..|:|.|.:........::..::|..|..||..::|..|::..|:|...| |.|..:|:  ::.|
  Fly    77 PLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPCIYHS--LEPR 139

  Fly   140 ICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQ 204
            ..::.|||..:.|..| |.:......:.....|||::||....:.:.:..|..:|          
  Fly   140 KVMIFEDLVPQGYYVI-RDRPVAQEELKTAFAKLAKWHAISMKYIKEQPDFLKEF---------- 193

  Fly   205 KSKSYQARLQSYKT-AIASWGLADHEQYVSRIP-----------TADQFVQSYASCF-----NNN 252
              |.....:.:.|| ...:.|:....:.:.|:|           ..|:::|...:..     |..
  Fly   194 --KYGLFEMPTVKTDPFITTGMQSFIEMLDRLPELRKYKPHFEKIKDKYMQRLQAVMKEYHENRK 256

  Fly   253 PQEFKVLNHGDFWSSNIMLSYTQ-TGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYF 316
            ...|.||.||||...|:|....: ||.......||||:........||...|........|.:..
  Fly   257 SDAFYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMG 321

  Fly   317 DYFIRIYHTHLVRCLKILKYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPDTEASLVKL 381
            ...|..|.|.||..||.:.|...:|...:|...:.|..::.:|...|.|..||........:..|
  Fly   322 KDLINHYLTVLVATLKSIGYPGELPTQAKLWDEIHKNKYYDFFLLSTFLPLILAIKSKSFKVNDL 386

  Fly   382 TQPGEEGDRFRSKVYTNPLYVRSALSIFP 410
            .|..|.    |.|.|....||:....:.|
  Fly   387 IQDPET----RQKTYFLDTYVKDVSKLLP 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 71/306 (23%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 71/306 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55451
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.