DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG31099

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster

Alignment Length:418 Identity:113/419 (27%)
Similarity:206/419 (49%) Gaps:35/419 (8%)


  Fly    15 RIPAWINEAYFKRLLKREFREFRRILNLSIIPATPPGE-TYTSLLMRIVIDIELKDGFSQQKSYI 78
            :||.|::.....:.:.....:..:|  .|:||:....: ...::|:.|.:.::|:| |:.:|.:.
  Fly     5 KIPDWVSSLSLNQAVHSVLEDGVQI--TSVIPSVHLIQFRNCTVLLPIQVKVQLRD-FTMKKLFF 66

  Fly    79 VKTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHAEDIKGRICLV 143
            :.............:|.|.:|.:|..:|..::|.||::|.|.|..|.|.|:....:...|...::
  Fly    67 LLKAQHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQYVL 131

  Fly   144 QEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSKS 208
            .|||:.|.|:|:.|..||:...:.:||:|||:||||.||..::.|.|.:      |..|...:|:
  Fly   132 LEDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGAFSN------LLVNGVYTKA 190

  Fly   209 YQARLQS------YKTAIASWGLADHEQYVSRIPTADQ-FVQSYASCFNNNPQEFKVLNHGDFWS 266
            .::.||.      :.:.:..|.|.||  :..|:...:: .|.......:.:..||.||||.|.|.
  Fly   191 NESVLQELNDPEIFLSQLRRWRLGDH--FHKRLVEKEKDLVDGLLKLHSPDSNEFNVLNHSDCWV 253

  Fly   267 SNIMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVRCL 331
            :|:|..:..:|.:.....:|:||.|:||||.||:..|:.||...|::..||..::.|..||:..|
  Fly   254 NNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNL 318

  Fly   332 KILKYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPDTEASLVKLTQ-PGEEGDRFRSK- 394
            |.|.:...:|.|:.:..::.|.|...|.     :|...||      :..:.| ..|..:|:.|| 
  Fly   319 KALNFGGSLPQLQHIRDALNKNGLAAYV-----VVTRALP------ITMMNQFEDEVNERYASKM 372

  Fly   395 ---VYTNPLYVRSALSIFPFLLRRGILD 419
               ::|:..|:::...|.|::..|.:|:
  Fly   373 KCAMFTSRKYIQAIKDILPWMEERSLLN 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 87/294 (30%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 87/288 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131025419
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4024
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.