DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG1561

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_996412.1 Gene:CG1561 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster

Alignment Length:383 Identity:85/384 (22%)
Similarity:153/384 (40%) Gaps:81/384 (21%)


  Fly     2 PDNSNKFSASSDVRIPAWINE---AYFKRLLKREFREFRRILNLSIIPATPPGETYTSLLMRIVI 63
            |....:.:|..|..:|   ||   .:.::|:.:.:.|......|.:..|:..|:.|..::.|   
  Fly   209 PVEQQEDTAKPDEDLP---NEQVTQFLRQLVSQLWPELGANPELRLERASAKGDNYLGVVWR--- 267

  Fly    64 DIELKDGFSQQKSYIVKTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSV---K 125
               |:.....::|.:||....:......|. ....|.:|...||..:| |..|.::....:   :
  Fly   268 ---LQAASDSKRSLVVKLPPQNRVRRKQFF-ARPCFLRETAAYEVFLP-LTALIQDKWKIIGDDR 327

  Fly   126 FAPK--CHHAEDIKGRICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHA---AGA---- 181
            |...  |......:...|:|.|||....:...||.....:.|:.||:...|:.||   ||.    
  Fly   328 FRQHALCFGTRQDEPNECIVLEDLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHAISLAGKRQLP 392

  Fly   182 -----------VWRQRKGPFPDD--------------FQRIYLPANYQKSKSYQARLQSYKTAIA 221
                       ::.||:    ||              ...:..||:    .:|:.||::|     
  Fly   393 EKMQQLQQLVDIFEQRR----DDHALGVYFENLKESALSALLAPAD----DAYRVRLEAY----- 444

  Fly   222 SWGLADHEQYVSRIPTADQFVQSYASCFNNNPQEFKVLNHGDFWSSNIMLSYTQTGDINQVRFVD 286
               .|....:...:|....|          |.:.|.|:.|||.|::||:...|:.|::..||.:|
  Fly   445 ---FARGSYFELLLPLVSGF----------NCEPFAVICHGDCWNNNILYKSTERGELEDVRLID 496

  Fly   287 FQLCKWGSPAQDL-WELIICSARHSIRIQYFDYFIRIYHTHLVRCLKILKYSERIPML 343
            :||.::.||..|| :.|..|::|. .|.::.:..:..|:..|  .|::::..||:..|
  Fly   497 WQLMRYASPVTDLAYFLFTCTSRR-FRQRHLENMLEDYYEEL--GLQLIRLGERVEQL 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 72/324 (22%)
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 72/326 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59495
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.