DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG31975

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster

Alignment Length:380 Identity:89/381 (23%)
Similarity:159/381 (42%) Gaps:64/381 (17%)


  Fly    38 RILNLSIIPATPPGETYTSLLMRIVIDIELKDGFSQQKSYIVKTMLDDAQGNGGFVNTLNIFPK- 101
            |:||......|.||:.|.|:|:.|...::..:|.|.::..:.|....|              || 
  Fly    24 RLLNYHTSSLTKPGDNYGSVLLAIHARLQKSNGESFEEQLVAKVPPID--------------PKY 74

  Fly   102 ------------EKMMYETIIPNLEQLYEEAGL----SVKFAPKCH--------HAEDIKGRICL 142
                        |..:|:.:.|.|..|.:|||:    ..|..|:.:        ::..:.....|
  Fly    75 WQFFQPEQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQNAVL 139

  Fly   143 VQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSK 207
            |.|:|::..|.:..|||.||:||....|:.:|||||.....|..:   |:.|:....|  :.|..
  Fly   140 VLENLRSSGYVSGQRLKAFDLAHTLLALKYMAEFHALSLALRILR---PEVFREQVRP--FFKKF 199

  Fly   208 SYQARLQSYKTAIASWGLAD-------HEQYVSRI-PTADQFVQSYASCFNNNPQEFKVLNHGDF 264
            .:.|....:|:.:.:..|.|       ..:.|:|: ..:|||.:..|:..:.....|..:.|.||
  Fly   200 DWHAEAPEWKSVMKAETLEDIRRATNNDSRLVARMKELSDQFFEFLAAAPDRPDGPFTSIIHCDF 264

  Fly   265 WSSNIMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVR 329
            |.:|||..|..||...:::.:|||..::.|...|:...::.|...:|....|::.:..|:....|
  Fly   265 WINNIMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFEHMLEAYYEAFER 329

  Fly   330 CLKILKYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFI--------LLPPDTEA 376
            ||:.:.....:...:|..:.:.:..    :....|.:|:        .|..|:||
  Fly   330 CLRRVGAKLEVHTFKEFRLEVKRVA----YIQVPHAIFMTRFILADSALIGDSEA 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 78/319 (24%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 78/318 (25%)
APH <214..329 CDD:279908 28/115 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59306
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4024
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.