DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG31436

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster

Alignment Length:445 Identity:98/446 (22%)
Similarity:177/446 (40%) Gaps:59/446 (13%)


  Fly     2 PDNSNKFSASSDVRIPAWINEAYFKRLLK-REFREFRRILNLSIIPATPPGETYTSLLMRIVIDI 65
            |.| |:|: ..::..|.|:|..:..|:|: .|.....::::|:..||:..|:.|.|::.|..:..
  Fly     5 PQN-NQFN-DDELVPPEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKY 67

  Fly    66 ELKDGFSQQKSYIVKTMLDDAQGN-----GGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVK 125
            ..:.| ..|||.|:||| .:|:|:     ||    ..||..|..:|..::|..|::..:.|...:
  Fly    68 TNRKG-EFQKSLIIKTM-PEAEGHKKDMLGG----SPIFETEMGLYTKVLPEFERILRQVGDDTQ 126

  Fly   126 FAPKC-HHAEDIKGRICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGP 189
            ....| :|:  ::....|:.|||....| .:.|.:...:..:.|:..|||::||.....:..:..
  Fly   127 LYVNCIYHS--LEPHQVLIFEDLAEMGY-IVLRDRDATLDEIRRIYFKLAKWHAVSLKVQNEQPE 188

  Fly   190 F---------------PDDFQR------IYLPANYQKSKSYQARLQSYKTAIASWGLADHEQYVS 233
            |               .|.|.|      :.|.....:...|:...:|.|           :.::.
  Fly   189 FLESYTHGLFEMPHVLNDPFMRTGMEFFVELLGKEPELNKYKPYFESIK-----------DDFLE 242

  Fly   234 RIPTADQFVQSYASCFNNNPQEFKVLNHGDFWSSNIMLSYTQTGDINQVRFVDFQLCKWGSPAQD 298
            |:....:.::.     :....|:.||.|||....|||..:..|..:.....:|||:........|
  Fly   243 RLVEEWKDIRK-----SQKKDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFD 302

  Fly   299 LWELIICSARHSIRIQYFDYFIRIYHTHLVRCLKILKYSERIPMLRELHMSMIKYGFWGYFTTFT 363
            |...|........|...:|..|..|.:.|...||.:.|...:|....|...:.::.::.:|...|
  Fly   303 LLYSIYMLLEPEHRWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEFFLIST 367

  Fly   364 HLVFILLPPDTEASLVKLTQPGEEGDRFRSKVYTNPLYVRSALSIFPFLLRRGIL 418
            .|..:....|.......|.|..|:    |.|...:..|::....:...|.:.|:|
  Fly   368 FLPLMWALRDKSVDFGDLLQNEEK----RRKCSFSKGYIKEVTILLARLDQLGLL 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 69/313 (22%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 69/313 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55454
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.