DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG31380

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_733121.1 Gene:CG31380 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster

Alignment Length:437 Identity:114/438 (26%)
Similarity:183/438 (42%) Gaps:76/438 (17%)


  Fly    18 AWINEAYFKRLLKREFREFR-RILNLSIIPATPPGETYTSLLMRIVIDIELKDGFSQQKSYIVKT 81
            ||:...|.:..|:|.::... |:.::.|.||...||.|.::|.|    |.|......::..|.||
  Fly     3 AWLTAEYLEAALRRYYQNNELRVESMVINPALGKGENYGAILTR----IHLVYSSIVEEHLIAKT 63

  Fly    82 ML--DDAQGNGGFVNT------LNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHAEDIKG 138
            :|  :||:       |      .:|:.:|..:||.::|.|::|..|     :..||..|.:..:|
  Fly    64 VLEYEDAE-------TKMKKAPYDIYNRELEIYEQVLPKLQELAGE-----QLCPKILHIDRQRG 116

  Fly   139 RICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQR------------KGPF- 190
              .|:.|||..|.:....||:..|..|:..||.|||:..||.||....            ||.| 
  Fly   117 --ALIMEDLSYKGFVMAPRLQRLDEQHVSLVLRKLAKMQAASAVLENNLLENNFSLTEYDKGFFN 179

  Fly   191 --PDDFQRIYLP-----ANYQKSKSYQARLQSYKTAIASWGLADHEQYVSRIPTADQFVQSYASC 248
              .:.|...:|.     |||.|:::               |...|.:.:..:  |..::.....|
  Fly   180 RYTESFSAYFLGCLKSCANYLKTQA---------------GYEHHAKLLDEL--APYYMGLGLRC 227

  Fly   249 FNNNPQEFKVLNHGDFWSSNIMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRI 313
            |........||.|||.|::|:|..| :.|..:.|..:|||...||||..|:..|:..||...:|.
  Fly   228 FKQEQTHINVLTHGDLWTNNMMFKY-EAGVPSDVLLIDFQYAFWGSPTLDIHHLLNTSAVEQVRS 291

  Fly   314 QYFDYFIRIYHTHLVRCLKILKY-SERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLP-----P 372
            :.......:||...|..|:.|.: .:|:|..::.|:...:..|:.     .|...:|||     .
  Fly   292 ELQMKMRGVYHDVFVGELQRLGFKGQRLPSRKQFHLESEQKRFYA-----VHCGLLLLPVLLNTD 351

  Fly   373 DTEASLVKLTQPGEEGDRFRSKVYTNPLYVRSALSIFPFLLRRGILD 419
            :|:|....|......|...:.::|.||....|...:.......|:||
  Fly   352 ETDADFAALLSDQPRGMDMKRRLYLNPGIQDSIKQMVKHFELEGLLD 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 86/314 (27%)
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 86/314 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55761
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.