DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and CG2004

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster

Alignment Length:321 Identity:69/322 (21%)
Similarity:113/322 (35%) Gaps:73/322 (23%)


  Fly    46 PATPPGETYTSLLMRIVI--DIELKDGFSQQK---SYIVKTMLDDAQGNGGFVNTLNIFPKEKMM 105
            |:...|:.|.|.:.||.|  ..|.::|..:::   |.|||.|.|:......|.:.: .|..|...
  Fly    38 PSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPDNLHRRRLFRSVI-FFRNEINF 101

  Fly   106 YETIIPNLEQLYEEAGLSVKFAPK-------------CHHAEDIKGRICLVQEDLQTKKYRNINR 157
            |..::|.:|...:    |.:.|||             |....|.     :..||:..:.||...|
  Fly   102 YTKVLPAIEAFQK----SRQPAPKKPFVEYPRCLASLCDGVNDF-----IALEDVGPRGYRAPVR 157

  Fly   158 LKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSKSYQARLQSYKTAIAS 222
            .....:......:..|..||.                  :.|..|...||:::....|.:...  
  Fly   158 QDYISLEDALLTMRTLGRFHG------------------VALAFNALDSKNFEKAAGSLEETY-- 202

  Fly   223 WGLADHEQYVSRIPTADQFV-------------QSYASCFNNNP------------QEFKVLNHG 262
            :|....|.|...:..|:...             ::.|:.|...|            .:..|..||
  Fly   203 YGEHTREWYTGFLLLAENVATDAVKQIYPNSKYETVATNFLQPPLFDDLINLVSTRSKLSVFGHG 267

  Fly   263 DFWSSNIMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIY 323
            |.|:.|.:..|.:.|...::..:||||.:..|.|.||...|.......:|.|::|..:|.|
  Fly   268 DCWTPNFLTKYNERGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAY 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 68/318 (21%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 68/318 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.