DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31102 and nhr-246

Sequence 1:NP_001262951.1 Gene:CG31102 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans

Alignment Length:344 Identity:72/345 (21%)
Similarity:131/345 (38%) Gaps:79/345 (23%)


  Fly    54 YTSLLMRIVIDIELKDGFSQQKSYIVK--------TMLDDAQGNGGFVNTLNIFPKEKMMYETII 110
            :.|||.::.:..:..|   ..|..::|        :::::|   ||.|..::....|:.|:.|..
 Worm    43 FMSLLRKVRLHFDNDD---LPKHVVLKIPQNTKGCSVVENA---GGGVKNVDHSVVERFMHNTEC 101

  Fly   111 PNLEQLYEEAGLSVK--------FAPKCHHAEDIKGRICLVQEDLQTKKYRNINRLKGFDMAHMH 167
             |..:|:  :.||.|        .|.|......:.   .:|.|.|:..|..::  :.||:...:.
 Worm   102 -NYYKLF--SSLSEKPLQIPTTYLASKAGEKAPVP---VIVLEMLEDCKLHDL--IPGFNEDQLF 158

  Fly   168 RVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSKSYQARLQSYKTAIASWGLADHEQ-- 230
            :::::|.:.|.......:.|...||:            ||...:.......|.....||.:.:  
 Worm   159 KIVDELVKLHIFSLTTEKWKEIVPDE------------SKLAMSGFLQCMVADVGRKLAQNPELG 211

  Fly   231 ----YV-SRIPTADQFVQSYASCFNNNPQEFKVLNHGDFWSSNIMLSYTQTGDINQVRFVDFQLC 290
                || :.:.|...::|.....:.|..:. .|:.|||.|:..|:..    .:.|....||:|..
 Worm   212 VILSYVENTLDTDPNYLQKMRDEYINEERP-SVICHGDLWAPQILWD----KEDNIAGIVDWQAT 271

  Fly   291 KWGSPAQDLWELI-ICSARHSIRIQYFDYFIRIYHTHLVRCLKI-LKYS--------ERIPMLRE 345
            ..|||.:||..:: .|::     :|....|.:....|....||: ||..        |.|.:  |
 Worm   272 HRGSPMEDLHHILSTCTS-----VQNRKTFTKPLLDHYYNKLKVGLKEKGFKTTWTREEIDI--E 329

  Fly   346 LHMSMI--------KYGFW 356
            .:.|.|        ..|||
 Worm   330 YNYSFIYGASRTIFANGFW 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 64/307 (21%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 44/204 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.